(data stored in ACNUC7421 zone)

EMBL: CP000859.PE70

CP000859.PE70        Location/Qualifiers
FT   CDS_pept        78419..80347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0070"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sat:SYN_01983 chaperone protein; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65880"
FT                   /db_xref="GOA:A8ZRW3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRW3"
FT                   /protein_id="ABW65880.1"
FT                   /translation="MAKTIGIDLGTTNSCVAVMEGGEAKVITNPEGGRTTPSIVAINED
FT                   GERLVGQVAKRQAITNPENTVFGVKRLIGRKFDSAEVQHDIKVLPYKIEKAGNGDLRIN
FT                   LRDKQYSPAEISSFILADIKHTAEEYLGEKVTDAVITVPAYFSDSQRQATKDAGKIAGL
FT                   NVLRIINEPTAASLAYGLDKKKDEKIAVFDLGGGTFDISVLEIGDGVFEVKSTNGDTHL
FT                   GGEDFDLRVVDYLASEFKKDQGIDLRQDKMALQRLKEAAEKAKMELSSSPQTDINLPFI
FT                   TADANGPKHLNIKLSRAKLEELVEDLLDKMAKPCETALKDSGFSASQIDEVILVGGMTR
FT                   MPAVQDRVKKIFGKAPNKSVNPDEVVAIGAAIQAGVLQGDVNDVLLLDVTPLSLGIETL
FT                   GGVMTKLIEKNTTIPTKKSQVFSTAADNQPAVSIHVLQGEREMAANNKTLGRFDLADIP
FT                   AAPRGVPQIEVTFDIDANGIVAVSAKDLGTGKEQSIKITASSGLSKEEIDKLVKDAEAH
FT                   AEEDKNKRELVEAQNTADALIYQTEKSIKELGEDKLDNATKAEIQAKIEELKKAKETTD
FT                   TDQIKKLSDELTQASHKLAEAMYQKASQEGQQASGGDAGASADGGTSSAAGGDDDVIDA
FT                   DYEEAGK"
     atggctaaaa caataggaat cgatcttggt accaccaact cctgcgtggc cgtgatggaa        60
     gggggagagg caaaagtcat caccaacccc gagggcggcc gcaccacacc ctccatcgtt       120
     gccatcaacg aggacggcga acggctggtg ggtcaggtgg ccaagcgaca ggccatcaca       180
     aatccggaaa acacggtgtt tggcgtaaaa aggctgatcg gccggaaatt tgattcagcc       240
     gaagtccagc acgatatcaa ggtgctgccc tacaaaattg aaaaggcggg caacggcgac       300
     ctgcgcatca acctgcgtga caagcagtac agcccggcgg aaatatcctc ctttattctg       360
     gccgacatca agcacacggc agaagagtac ctgggtgaaa aagtcactga cgcggtgatt       420
     accgtgccgg cctatttttc cgacagccag agacaggcca ccaaagacgc cggcaaaatc       480
     gccggcctca acgtgctgcg cattatcaac gagcccacgg ccgcctccct ggcctacggc       540
     ctggacaaaa agaaagacga aaagatcgct gtattcgacc tgggcggcgg cacgtttgat       600
     atttccgtcc tggaaatcgg ggatggcgtg tttgaggtca aatccaccaa cggcgacacc       660
     cacctgggcg gcgaagactt tgacctgcgg gtggtggact accttgccag cgaattcaaa       720
     aaagaccagg gcattgacct gcgccaggac aagatggcgc ttcagcgatt aaaagaggct       780
     gcggaaaagg ccaagatgga gctctcctcc tctccgcaga ccgacatcaa cctgcccttt       840
     atcacggcgg acgccaacgg ccccaagcac ctgaacatca agctctcccg ggccaagctg       900
     gaagagctgg tggaggacct gctggacaag atggcaaagc cctgcgaaac cgcgctgaaa       960
     gactccggct tttccgcctc ccagatcgat gaggtgatcc tggtgggtgg catgacccgc      1020
     atgcccgcgg tgcaggaccg ggtgaaaaag atctttggca aggcccccaa caagagcgtg      1080
     aacccggacg aggttgtggc catcggcgct gccattcaag ccggtgtgct ccagggcgat      1140
     gtgaacgacg tgctgctgct ggacgtgacc ccgctttccc tgggcattga aaccctgggc      1200
     ggggtgatga ccaagctgat tgaaaaaaat accaccattc ccacgaaaaa gagccaggtc      1260
     ttttcaaccg cggctgacaa tcagccggcg gtgtcgattc acgtgcttca gggtgagcgg      1320
     gaaatggccg ccaacaacaa gaccctgggc cggttcgacc tggccgatat tccagcggcg      1380
     ccccggggtg taccccagat cgaagtgacc tttgacatcg acgccaacgg catcgtggcg      1440
     gtctcggcca aggacctggg cacgggcaag gagcagtcca tcaagatcac ggcctccagc      1500
     ggactttcca aggaggagat tgacaagctg gtcaaggatg ccgaggccca cgccgaagag      1560
     gacaagaata agcgggaact ggtggaggca cagaacacgg ctgacgccct gatctaccag      1620
     accgaaaaat cgatcaagga gctgggcgaa gacaagctgg acaacgccac aaaggccgaa      1680
     attcaggcca agatcgagga gctgaaaaag gccaaggaga ccacggacac agaccagatc      1740
     aaaaagcttt ccgacgaact gacccaggcc tcccacaagc tggccgaggc catgtaccag      1800
     aaggcctccc aggagggcca gcaggcctcc ggcggtgacg caggggcctc tgcggacggc      1860
     ggaaccagca gcgctgccgg cggtgatgat gatgtcatcg acgccgacta cgaagaagcc      1920
     ggaaaataa                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page