(data stored in ACNUC7421 zone)

EMBL: CP000859.PE76

CP000859.PE76        Location/Qualifiers
FT   CDS_pept        complement(85681..85911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65886"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW9"
FT                   /protein_id="ABW65886.1"
FT                   /translation="MKDGNKDKKIKAAISAAVLNYIKSEAEMAAVAGLVAANRGRSALE
FT                   QGPFVSRNTWGTDSRRTQMQLRTLMQLRSIK"
     atgaaggacg gaaacaaaga caaaaaaatc aaggccgcca tcagcgcggc ggttcttaac        60
     tatataaaga gtgaagcgga gatggcggcc gtggccggcc tggtggcggc caaccggggc       120
     cgctccgccc tggagcaggg accgtttgtc tccagaaaca cgtggggcac ggacagccgg       180
     cgaacccaga tgcagctgcg caccctgatg caactcaggt ccattaaata a                231
//

If you have problems or comments...

PBIL Back to PBIL home page