(data stored in ACNUC7421 zone)

EMBL: CP000859.PE83

CP000859.PE83        Location/Qualifiers
FT   CDS_pept        93215..94264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0083"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   pca:Pcar_1895 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65893"
FT                   /db_xref="GOA:A8ZRX6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX6"
FT                   /protein_id="ABW65893.1"
FT                   /translation="MFLVSDYDYDLPPDRIAQQPVTQRDSSRLLRLDRARGGISHHRFY
FT                   DLPDLLRPSDLLVVNNTRVVPARLEGIKETGGRAGALILDYPGVRTEKGVICRCMVKAS
FT                   GRLRPGTRFLFEDRLSASVVDAADGLYTLCFSCDGDFDQTLFAVGRTPLPPYITRNRDG
FT                   APCDDRTCYQTVYADRDGAVAAPTAGLHFTPNVLDRLAAKGISTAPVTLHVGHGTFLPV
FT                   RVSDIRDHAMHSERFEVPAATAAAINATRRDGGRVVAVGTTVVRTLEYVARTCGEIRAF
FT                   SGACDLFIYPGYNFQAIAAMITNFHLPRSTLLMLVSAFTGREKVLAAYEAAIQEKYRFY
FT                   SYGDAMLIE"
     atgtttcttg tctccgatta cgattatgac ctgccgccgg acagaatcgc ccagcagccg        60
     gtaacccaac gggacagcag ccgcctgctg cggctggacc gcgcccgcgg cggcatttcc       120
     catcaccggt tttacgacct gcccgacctg ttgcggccct cggacctgct ggtggtcaac       180
     aacacaaggg tggtgccggc ccggctggaa gggatcaagg agaccggggg ccgggccggg       240
     gcgctgatcc tggattaccc gggcgtccgc acggaaaaag gcgtgatatg ccgctgcatg       300
     gtcaaggcct cgggccgcct tcggccgggc acgcggtttc tctttgaaga caggctttcc       360
     gccagcgtgg tggacgccgc cgacggcctc tacacccttt gcttttcctg cgacggtgat       420
     tttgaccaaa cgctttttgc cgtgggacga accccgctgc cgccctatat cacacgaaac       480
     cgggacgggg ccccctgcga cgaccggacc tgttaccaga ccgtctatgc cgaccgggac       540
     ggggccgtgg ccgcgcccac ggccgggctt cactttacgc cgaacgtgct ggaccgtctg       600
     gcggcaaaag gcatctccac ggcaccggtc accctgcacg tgggccacgg cacctttctg       660
     ccggtgcggg tttccgacat tcgggaccat gccatgcaca gcgaacgatt tgaggtcccg       720
     gcagctacgg cggcagccat caacgccacc cggcgcgacg gcggccgggt ggtggctgtc       780
     ggcaccacgg tggtccgcac cctggagtac gtggcccgca catgcggcga gattcgcgcc       840
     ttttccggcg cctgtgacct gttcatctac ccggggtata attttcaggc catcgccgcc       900
     atgatcacaa attttcacct gccccggtcc accctgctga tgctggtctc cgcatttacc       960
     ggcagagaaa aggttctggc cgcctatgaa gcagccattc aggaaaaata ccggttctac      1020
     agctacggtg acgccatgtt gatagaataa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page