(data stored in ACNUC7421 zone)

EMBL: CP000859.PE88

CP000859.PE88        Location/Qualifiers
FT   CDS_pept        96616..97617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0088"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; PFAM:
FT                   GTP-binding protein HSR1-related; GTP1/OBG sub domain
FT                   protein; KEGG: sfu:Sfum_3641 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65898"
FT                   /db_xref="GOA:A8ZRY1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRY1"
FT                   /protein_id="ABW65898.1"
FT                   /translation="MKFIDEATITVSSGKGGRGCVSFRRERFVPRGGPDGGDGGSGGSL
FT                   LFRVNPSKRTLYAFRSKKQFAAPNGAPGEGRQKTGKSGDDLVIEVPPGTLIFDADTGAI
FT                   IRDMVSPEEDFVFLTGGRGGKGNKHFATSTHQTPRFAQPGEPAQTATVRLELKLLADVG
FT                   LIGLPNAGKSTLLSVISAARPAIGAYPFTTLSPNLGMVTLAGAEPFAVADIPGLIEGAH
FT                   TGAGLGIRFLKHIERTRLLVHLIDASAIDPADPVAPFRIINAELAMFSPALAERPQVVV
FT                   LNKMDLTGAEALAQQFINAAGIKKCFLISAATRSGVEELKKHLFELLCSHDT"
     ttgaaattca ttgacgaagc cacgatcacg gtcagctccg gcaagggcgg ccggggatgt        60
     gtcagtttcc gacgggaacg attcgtcccc cggggcggcc cggacggcgg agacggcggc       120
     agtggcggca gccttctctt tcgcgtaaat ccctccaaac gcacccttta cgcctttcgt       180
     tccaaaaaac agtttgccgc gcccaacggc gcgcccggcg aaggccggca gaaaaccggc       240
     aagtccggcg acgatcttgt cattgaggtg ccgccgggaa cccttatctt tgacgctgac       300
     accggcgcaa ttattcggga catggtttcc ccggaagaag actttgtgtt tctgaccggg       360
     ggccggggcg gcaaaggcaa caaacatttt gccacatcca cccaccagac cccccggttt       420
     gcccagcccg gagaaccggc ccagaccgcc acggtaaggc tggagctcaa actgctggcc       480
     gacgtgggcc tcatcggtct gcccaatgcc ggcaaatcca ccctgctctc cgtaatctcc       540
     gcggcccggc cggccatcgg cgcctatccc tttaccaccc tttcccccaa cctgggcatg       600
     gtaacccttg ccggtgccga gccttttgcc gtggctgata ttcccggcct gatcgaaggg       660
     gcccacaccg gggccggcct gggcatccgc tttttaaaac acattgagcg cacacggctg       720
     ctggttcacc tgatcgacgc ctccgccatc gacccggcgg atccggttgc cccctttcgg       780
     atcatcaacg cggaactggc catgttcagc ccggccctgg ccgaaaggcc acaggtggtg       840
     gtgttaaaca agatggacct taccggcgcc gaagcgctgg cccaacagtt tatcaacgct       900
     gccggcatta aaaaatgctt tctgatttcc gcggccaccc ggtccggggt ggaggagttg       960
     aaaaaacatc tgtttgagtt attatgcagc catgacacct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page