(data stored in ACNUC7421 zone)

EMBL: CP000859.PE92

CP000859.PE92        Location/Qualifiers
FT   CDS_pept        100724..101068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0092"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: sfu:Sfum_3646 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65902"
FT                   /db_xref="GOA:A8ZRY5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY5"
FT                   /protein_id="ABW65902.1"
FT                   /translation="MTASSKTEIEPYLTAINGMKAENVVALDVSRLTSIADVFILCEGR
FT                   SNRQVSAISDHIVKALKDQGIKPLSMEGVSEGRWVLLDYGDVIIHVFYESVRAFYDIEG
FT                   LWADARRIEV"
     atgacagctt catcgaaaac ggagattgag ccttacctta ccgccatcaa cggcatgaag        60
     gcggaaaacg tcgtggccct ggatgtgagc cggctgacct ccatcgctga tgtgtttatt       120
     ctctgcgaag gccgttccaa ccggcaggtg tcggccatca gcgaccatat cgtcaaagca       180
     ctaaaagacc agggcatcaa gcccctgtcc atggagggcg tctcagaggg ccgctgggtg       240
     ctgctggatt acggcgatgt gattattcac gtgttttacg aatcggtgcg cgctttctat       300
     gatattgaag ggctgtgggc cgatgcccgg cggattgaag tttaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page