(data stored in ACNUC7421 zone)

EMBL: CP000859.PE95

CP000859.PE95        Location/Qualifiers
FT   CDS_pept        104210..106654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0095"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sat:SYN_02049 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65905"
FT                   /db_xref="GOA:A8ZRY8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY8"
FT                   /protein_id="ABW65905.1"
FT                   /translation="MKKEEIKEAYNESSINVLEGLEPVRKRPSMYIGNVDKEGLHHLVY
FT                   EVVDNSIDEAMAGYCDFIHVIIHKDNTVSVVDNGRGIPVGMHEKEHVPAVEVVLTKLHA
FT                   GGKFDNNNYKVSGGLHGVGISVVNALSSFLEVNVYRDGKIYKQTFSEGQKTSELEIIGD
FT                   TTQRGTKIIFKPDTTIMNTDNFSFDILTRRLRELAFLNNGVRIKIEDHRSDESAEFFYE
FT                   GGLATFVDYLNRAHAVLHKPIYISGEKNDVQIEAAIQYNDSYSETMYSFANNINTVEGG
FT                   FHLIGFKGALTRSINQYAASQGGGSSKKNGDKITGDDVREGLTAVISVRIKNPQFEGQT
FT                   KTKLGNSEVKGYVDSLVYEKLNIFLEENPSVGKIIIKKATEAARARNAAKKARDIARSQ
FT                   GSLLDSSLPGKLAECQSSIPAERELFLVEGDSAGGSAKQGRDRRFQAILPLKGKILNIE
FT                   KARFDKILKSEEIKNIITVLGTGVGSEEYNIEKIKYHKVIIMTDADVDGAHIRTLLLTF
FT                   FFRQMQDLIKQGHLYIAQPPLFKVGRGKKEVYIDSELLLKDYFIQNACEKKYVKTGEKK
FT                   LQDHELYLFLCNLSEFISEMAGLKRRGYNSKLIETLIRQNIREKSLLQDRDRVAALQQT
FT                   LSENGFVVDDVLYNEEKEMYEFLVTIPLHEDEEEAVTGSAKKDIKPVRIGRNLIYSNRY
FT                   QNIVMLSEKIAPYNVPPFTVYNSDTDQEEARFDTVKQLYQYMEALGKKGVVFQRYKGLG
FT                   EMNADQLWQTTMEPETRKLLKVTIDDAAEADAVFTLLMGDVVEPRKKFIQENALEVETL
FT                   DI"
     atgaaaaaag aagaaattaa agaagcttat aatgaaagca gcatcaatgt acttgaaggt        60
     ctggaacctg tgcggaaaag gccttccatg tatatcggta atgtggataa agaaggcctt       120
     caccacctgg tttatgaagt ggtggacaat agtattgacg aagccatggc tgggtactgt       180
     gactttattc atgtcatcat tcacaaggac aacaccgtca gtgtggtgga caacggccgg       240
     ggtattccgg ttggtatgca tgaaaaagag catgtaccgg cggtagaggt ggtgctgacc       300
     aagctgcatg ccggcggcaa gtttgacaac aataactaca aagtttccgg cggtcttcat       360
     ggtgtgggaa tttccgttgt aaacgccctt tcatcctttc tggaagtaaa tgtttacaga       420
     gacggaaaga tatataaaca gaccttttca gaaggacaga aaaccagcga actggagatt       480
     ataggcgata ccacccagcg gggaacgaaa attattttca aacccgacac aaccataatg       540
     aacaccgaca atttcagttt tgatattctg acccgccggt tgagagaact ggcgttttta       600
     aataacgggg ttcgaattaa aatagaggac caccgctccg acgagtccgc tgaattcttt       660
     tatgagggcg ggcttgccac ctttgtggac tatctgaaca gggcacacgc ggttcttcac       720
     aagccgatct atatttcagg cgaaaaaaac gatgtccaga tagaggccgc gattcagtat       780
     aacgacagtt attctgagac catgtactcg tttgcgaaca acatcaatac cgtggaaggt       840
     ggatttcacc tgatcggatt taaaggggcc ctgacccggt ccatcaatca gtatgccgcc       900
     agccagggcg gtggctcttc caaaaagaac ggagataaaa taaccggtga tgatgtgagg       960
     gaagggctga ccgcggttat cagcgtgcgt ataaaaaacc cccagtttga aggacagacc      1020
     aaaaccaagc tgggcaacag cgaggtaaaa ggatatgtcg actcgctggt ttatgaaaaa      1080
     ctcaatatct ttttagaaga aaatccgtct gtcgggaaaa tcattataaa aaaggccaca      1140
     gaagcggcca gggccagaaa tgcggccaaa aaagcaagag acatcgcccg aagccagggc      1200
     tccttgctgg attccagtct tccggggaaa ctggcggaat gccagtcctc catcccggct      1260
     gaacgtgaac ttttcctggt ggagggagat tccgccggcg gttcagccaa gcagggaaga      1320
     gaccggcggt ttcaggcgat tctgcccctt aaaggtaaaa ttttaaacat agaaaaagcc      1380
     cggtttgata agattttaaa aagcgaggag ataaaaaaca tcatcacggt tctgggtacc      1440
     ggcgtcggca gtgaggaata taatattgag aagataaaat atcacaaggt tattatcatg      1500
     accgatgccg atgtggacgg cgcccatatt cggacactgc tcttaacctt cttttttagg      1560
     cagatgcagg acctgatcaa acagggacat ctttatatcg cccagccccc cctgttcaaa      1620
     gtgggaaggg gaaaaaaaga ggtctatatt gacagcgagc ttctgctcaa agactatttt      1680
     attcaaaatg cctgtgaaaa aaagtatgtg aaaacaggcg aaaaaaaatt acaagaccat      1740
     gagctgtatc tctttttatg taacctttct gaatttataa gtgaaatggc cggactcaag      1800
     agaaggggat ataattcaaa actgattgag acgctgattc gccagaacat tcgggaaaaa      1860
     agccttcttc aggacaggga ccgggtggcg gcccttcagc agaccctgtc ggaaaacggg      1920
     tttgtcgtgg atgatgtgct gtataacgag gaaaaagaga tgtatgaatt tctggtcacc      1980
     attcccctgc acgaggatga agaggaggcg gtcaccggtt cggccaaaaa agatatcaag      2040
     ccggtgagaa tcgggcgcaa cctgatctac tccaaccggt accagaacat cgtgatgttg      2100
     tcggaaaaga tcgcccccta caacgtgcca ccgtttacgg tatacaacag cgacaccgac      2160
     caggaggagg cccggtttga cacggtcaaa cagctttacc aatatatgga ggcccttggg      2220
     aaaaaaggcg tggtgttcca gcgatataaa ggcttgggtg agatgaatgc cgaccagttg      2280
     tggcagacaa caatggaacc ggaaacccga aagctcttaa aagtcaccat tgacgacgcg      2340
     gcggaagctg acgcggtgtt taccctgctg atgggtgatg tggtggagcc ccgcaagaag      2400
     ttcatccagg aaaacgccct ggaggtggag acgctcgata tttaa                      2445
//

If you have problems or comments...

PBIL Back to PBIL home page