(data stored in ACNUC7421 zone)

EMBL: CP000859.PE97

CP000859.PE97        Location/Qualifiers
FT   CDS_pept        108032..110485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0097"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: gur:Gura_0300 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65907"
FT                   /db_xref="GOA:A8ZRZ0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ0"
FT                   /protein_id="ABW65907.1"
FT                   /translation="MQTGLNGSLLASVRKPSTYLGNEINTIRKDPASVDLLMALCFPDL
FT                   YEIGTSHFGLQILYHILNRDKQIAAERVFSPGPDMEALLRTTGRSAFSLESRRPLETFN
FT                   IIGFSLLYELNYTNILTLLDLSGIPFYAADRKAAHPLVIAGGPCTVNPEPVADFFDAMV
FT                   IGDGERVTEEMCRAWLEIKKSSGTVDRAEILDRWSSIEGVYVPSLFTATYDADGFQHLA
FT                   PAKKDYIRVTRAVVPHLTAADFPNTPVVPYGKPVHDRLRLEIARGCTRGCRFCQAGMIY
FT                   RPVRERPVEDLLALAGQALEATGYEDLSLLSLSTGDYSRLHHLLERMLSVHGKDNVAVS
FT                   VPSFRAGSLGQEEMGLIRSVRKTGFTIAPEAGTQRLRDVINKNITEEEIVHTVSDAFGL
FT                   GWNLIKTYFMVGLPTETDADIDGIVSLVSRLARIKAPGGRGKKLHVSVAAFIPKSHTPF
FT                   QWEPQVSVARAKELIFSLKRRLESGKVGFKWQHPETSLLEGLFARGDRRLSALIEAAWR
FT                   RGCRFDGWSDSFDFAAWQAAAEDCDLDMEASVTRKREITEPLPWDHVFTGVSRVFLEKE
FT                   RDSAYGARLTPDCRDQECSGCGVCDFETVAPRLSPAPAPVQEGLAPGRQNLPPVCLEVS
FT                   YSKTGEARFFGHLEFIAILSRAIRRARVPVVFSQGFHPKPKLSFSDPLPVGMESECERF
FT                   WMTVYGPADPEAIRQALNRCLPDGFFLHECRMVATRKDKSSGRTGPAVYNITINQDLFD
FT                   ARHEVPAPSETDPFAITVLDPRNLVLEIRQRQKGLSSPGQIVASVFGVDEALIVQGRVV
FT                   KRAGL"
     atgcaaaccg gtttgaacgg cagtctgctg gcgtccgtca gaaaacccag cacctacctg        60
     ggtaacgaga taaacaccat ccgaaaagat cccgcctcgg tcgatctgtt gatggcgctc       120
     tgctttcccg atctttatga gatcggcacc tcccatttcg ggcttcagat tctataccac       180
     attctaaacc gggacaagca gatagcggcc gaacgggttt tttctccagg accggacatg       240
     gaggcccttc tgcggacaac aggccggtcc gccttttccc tagagagccg gcgcccactg       300
     gaaaccttta atattatagg gttttcgctt ctttacgagc tcaactacac caatattctg       360
     actctcctcg atctttccgg tattcctttt tacgcggccg accgaaaagc ggcccacccc       420
     ctggtgattg ccggcggccc ctgcaccgtg aacccggagc cggtggccga tttttttgac       480
     gccatggtga tcggcgacgg ggagcgggtg acagaagaga tgtgccgggc ctggctggag       540
     atcaaaaaaa gcagcggcac cgtagaccgg gctgaaattc tggaccggtg gtcttccatt       600
     gaaggggtct atgtgccctc cctgtttaca gccacgtatg acgccgacgg ttttcagcac       660
     ctggccccgg caaaaaaaga ttacatccgg gtgacccggg ccgtggtgcc ccacctgacc       720
     gcggcggatt ttcccaacac cccggtggtg ccttatggca aacccgttca tgaccggctt       780
     cgcctggaaa tcgcccgggg atgcacccgg gggtgccggt tctgccaggc cggcatgatc       840
     tatcggccgg tgcgggagcg gccggtggaa gacctgctgg ccctggccgg ccaggccctg       900
     gaggccacgg gctatgaaga cctctctctt ctttccctca gcaccggcga ctacagccgg       960
     ctgcaccacc tgttggaacg gatgctctct gttcacggca aagacaacgt cgcggtttcc      1020
     gtgccctcct ttcgcgccgg ttccctgggc caggaggaga tgggcctgat ccggtcggtg      1080
     cgcaaaaccg ggtttaccat tgcgccggag gccggcactc agcggctgcg ggacgtgatc      1140
     aacaagaaca tcaccgaaga ggagatcgtt cacaccgtat ccgacgcctt tggcctgggg      1200
     tggaacctga tcaagaccta cttcatggtg ggcctgccca ctgagaccga cgcggacatc      1260
     gacggcatcg tctctctggt ttcccggctg gcccgcatca aagcgccggg gggccgggga      1320
     aaaaagctgc atgtgagcgt ggccgccttt attcccaagt cccacacccc gtttcaatgg      1380
     gagccccagg tttccgtggc ccgggccaaa gagcttattt tttctcttaa aagacgcctg      1440
     gaatccggaa aggtcgggtt taaatggcag cacccggaaa caagcctttt ggaagggctt      1500
     tttgccaggg gagaccggcg gctgtcggcc ctgattgaag cggcctggcg ccgggggtgc      1560
     cggtttgacg ggtggagcga cagctttgat tttgccgcct ggcaggcggc cgccgaggac      1620
     tgtgatctgg acatggaggc gagcgtcacc aggaaaaggg agatcacgga accgcttccc      1680
     tgggaccatg tttttacagg ggtttccagg gtctttctgg aaaaagagcg cgacagcgcc      1740
     tatggggcac ggctcacgcc ggactgccgg gaccaggaat gcagcggctg cggggtctgt      1800
     gactttgaaa ccgttgcgcc ccggctgtct ccggcgccgg cgccggtcca ggagggcctg      1860
     gccccgggcc ggcagaacct gccaccggtc tgcctggagg tttcctattc aaaaacagga      1920
     gaggcccggt ttttcggaca cctggagttt atcgccattc tttcccgggc cattcgccgg      1980
     gcgcgggttc cggttgtgtt ctcccaggga tttcacccaa agccaaagct ctctttttcc      2040
     gatccactgc ccgtgggcat ggaaagcgaa tgcgagcggt tctggatgac cgtttatggc      2100
     ccggccgatc cggaggcgat ccgccaggcc cttaaccggt gtctgcctga cgggtttttt      2160
     cttcacgaat gccgcatggt ggccaccaga aaagacaaat cttccggccg caccggtccc      2220
     gcggtttaca acatcaccat caaccaggac ctgtttgatg ccagacacga agtgcctgcc      2280
     ccatcggaaa cagacccgtt tgccatcacc gttttagacc cccggaacct ggtgctggag      2340
     attcgacagc gccagaaggg gttgtcgtct cccggccaga tcgttgcctc ggtctttggc      2400
     gtggacgagg ccctgattgt tcagggccgg gttgtgaagc gggccggttt ataa            2454
//

If you have problems or comments...

PBIL Back to PBIL home page