(data stored in SCRATCH zone)

EMBL: CP000880.PE103

CP000880.PE103       Location/Qualifiers
FT   CDS_pept        100026..100697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00104"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14128 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20057"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA5"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217788.1"
FT                   /protein_id="ABX20057.1"
FT                   /translation="MLKNIPIPSPLSPVEGILIKRKTLERYFSIERLEQQAHQRAKRIL
FT                   REAEEEARTLRMYAYQEGYEQGMVDALQQVAAYLTDSQTMAWKWMEKIQIYARELFSAA
FT                   VDHPETLLTVLDEWLRDFDKPEGQLFLTLPVNAKKDHQKLMVLLMENWPGTFNLKYHQE
FT                   QRFIMSCGDQIAEFSPEQFVETAVGVIKHHLDELPQDCRTISDNAINSLIDEWQTKTQT
FT                   S"
     atgctcaaaa atatcccaat tccgtccccg ctttcgcctg ttgaggggat actgataaag        60
     cgtaaaacgc tggaacgcta tttttctatt gagagattag aacagcaggc gcatcaacgg       120
     gctaagcgta ttttacggga ggcggaagaa gaggcaagga ccttgcggat gtatgcctat       180
     caggaaggtt acgaacaggg aatggttgat gcgttacagc aggtcgctgc ttatcttacc       240
     gatagtcaga caatggcctg gaaatggatg gaaaaaatac agatttatgc ccgagagtta       300
     ttttcagcag cagtcgatca tcccgaaacg cttttaaccg tactggatga gtggttgaga       360
     gatttcgata aaccggaggg acaacttttt ttaacgctgc cagttaatgc taaaaaagat       420
     catcaaaaac tgatggtgtt gcttatggaa aactggcctg gcacttttaa tcttaaatat       480
     catcaggaac agcgttttat catgagctgc ggcgatcaga tcgcagagtt ttctcctgaa       540
     caatttgttg aaacggcggt aggcgtcatt aagcatcatc ttgatgaact gccgcaagac       600
     tgccggacga tttctgataa cgccatcaat tcacttattg atgagtggca gacaaaaacg       660
     caaacatcat aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page