(data stored in SCRATCH zone)

EMBL: CP000880.PE115

CP000880.PE115       Location/Qualifiers
FT   CDS_pept        complement(112209..112481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00116"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0298 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20069"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW1"
FT                   /inference="protein motif:BlastProDom:IPR001109"
FT                   /inference="protein motif:FPrintScan:IPR001109"
FT                   /inference="protein motif:HMMPfam:IPR001109"
FT                   /inference="protein motif:HMMPIR:IPR001109"
FT                   /inference="protein motif:HMMTigr:IPR001109"
FT                   /inference="protein motif:ScanRegExp:IPR001109"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:INSD:CAD05963.1"
FT                   /protein_id="ABX20069.1"
FT                   /translation="MCIGVPGQIRAIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRLG
FT                   QWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEER"
     atgtgcatag gcgttccggg tcaaatccgc gccattgacg gcaaccaggc gaaagttgac        60
     gtttgcggca ttcagcgcga tgtcgatctc acattagtcg gcagttgtga tgaaaacggt       120
     cagccgcgtc tgggtcagtg ggtgctggtt catgtcggat tcgccatgag cgtcattaac       180
     gaagcagaag cgcgcgatac gctcgacgcg ctacagaaca tgtttgatgt tgagccggac       240
     gtcggcgcac tgttgtatgg tgaggagaga taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page