(data stored in SCRATCH zone)

EMBL: CP000880.PE126

CP000880.PE126       Location/Qualifiers
FT   CDS_pept        121479..121916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2778 7.5e-72 hycI, hycE; protease
FT                   involved in processing C-terminal end of HycE K08315; COG:
FT                   COG0680 Ni,Fe-hydrogenase maturation factor; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20080"
FT                   /db_xref="GOA:A9MFX2"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004420"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX2"
FT                   /inference="protein motif:Gene3D:IPR000671"
FT                   /inference="protein motif:HMMPfam:IPR000671"
FT                   /inference="protein motif:HMMPIR:IPR000671"
FT                   /inference="protein motif:HMMTigr:IPR000671"
FT                   /inference="protein motif:HMMTigr:IPR004420"
FT                   /inference="protein motif:HMMTigr:IPR006227"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217765.1"
FT                   /protein_id="ABX20080.1"
FT                   /translation="MMGDDGAGPLLAEKCVAQPKGNWVVIDGGSAPENDIVAIRELRPD
FT                   RLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLVDQLKEDVGEVIFLGIQP
FT                   DIVGFYYPMTQPIKDAVDTVYQRLEGWLGHGGFAALEAPEA"
     atgatgggtg acgacggcgc ggggccgttg ttggcggaaa aatgcgtcgc gcagccgaag        60
     ggtaattggg tggtgattga tggcggcagc gcgccggaaa acgacattgt ggcgattcgc       120
     gaactgcgcc ccgaccgcct gctgattgtc gacgctaccg acatgggact taatccgggc       180
     gagatccgca ttatcgatcc ggatgatatc gccgaaatgt ttatgatgac tactcacaat       240
     atgccgctga actatctggt cgatcagctt aaagaggatg tcggcgaggt catctttctc       300
     ggtatccagc cggatatcgt cggattttat tatccgatga cccagccgat taaggacgcg       360
     gtagacaccg tctatcagcg cctggagggg tggctaggtc acggcggatt tgccgcgctt       420
     gaagcgccgg aggcataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page