(data stored in SCRATCH zone)

EMBL: CP000880.PE140

CP000880.PE140       Location/Qualifiers
FT   CDS_pept        134736..135668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2689 6.6e-167 mltB; membrane-bound
FT                   lytic transglycosylase B precursor K08305; COG: COG2951
FT                   Membrane-bound lytic murein transglycosylase B"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20094"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY6"
FT                   /inference="protein motif:HMMTigr:IPR011757"
FT                   /inference="similar to AA sequence:INSD:AAV78546.1"
FT                   /protein_id="ABX20094.1"
FT                   /translation="MGGDFANNPNAQQFIDKMVSKHGFDRQQLQEILSQSKKLDYVLRL
FT                   MDRQAPTTQPPAGPNGAWLRYRKQFITPDNVQNGVAFWNQYEDALNRAWQVYGVPPEII
FT                   VGIIGVETRWGRIMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARNEQDDPLNLK
FT                   GSFAGAMGYGQFMPSSYKEYAVDFNGDNHINLWDPVDAIGSVANYFKAHGWVKGDVVAI
FT                   PANGQAPGLANGFKTKYSVSQLAAAGLTPQQSLGNHQEASLLRLDVGTDYQYWYGLPNF
FT                   YAITRYNHSTHYAMAVWQLGQAVALARVR"
     atgggcggcg acttcgccaa caaccctaat gcgcagcagt tcattgataa aatggtcagt        60
     aaacacggtt tcgaccgtca gcaactgcaa gagatcctct cccagtctaa aaaactggat       120
     tacgttctgc gtctgatgga cagacaagcg ccaaccactc agccgcccgc cgggccaaat       180
     ggcgcctggc tgcgctaccg caaacaattt attacgccgg ataacgtgca aaacggcgtc       240
     gcgttctgga atcagtatga agacgcgctg aaccgcgcct ggcaggtata cggcgtaccg       300
     ccggagatta tcgtgggcat tatcggcgtg gaaacccgtt ggggacgcat catggggaaa       360
     acgcggattc tggacgcgct ggcgacgctg tcatttaact atccgcgtcg ggcggaatac       420
     ttctccggcg agctggaaac cttcctgcta atggcgcgca atgaacaaga tgatccgctc       480
     aatctgaaag gttcctttgc gggcgcgatg ggctatggtc agtttatgcc gtcctcttat       540
     aaagaatacg cggttgattt taatggcgac aatcacatca acctatggga cccggtggat       600
     gctattggta gcgtggcgaa ctatttcaag gcgcatggtt gggtgaaagg cgatgtggtc       660
     gcaatacccg ctaatggcca ggcgccggga ctggcaaatg gtttcaaaac aaaatacagc       720
     gtctctcagc ttgccgccgc aggcttaacg ccgcagcaat cgttgggcaa tcatcaggaa       780
     gccagcctgc ttcgtctgga tgtcggtact gactaccagt actggtacgg cctgccgaat       840
     ttctacgcca ttacccgcta taaccacagc acgcattatg cgatggcggt gtggcaactg       900
     ggacaggcgg tagcgctggc acgggtgcgc taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page