(data stored in SCRATCH zone)

EMBL: CP000880.PE146

CP000880.PE146       Location/Qualifiers
FT   CDS_pept        141225..141410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00147"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1551 Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20100"
FT                   /db_xref="GOA:A9MFZ2"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFZ2"
FT                   /inference="protein motif:BlastProDom:IPR003751"
FT                   /inference="protein motif:HMMPfam:IPR003751"
FT                   /inference="protein motif:HMMTigr:IPR003751"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:INSD:AAN44211.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20100.1"
FT                   /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHRE
FT                   EIYQRIQAEKSQQSSY"
     atgctgattc tgactcgtcg agttggtgag accctcatga ttggcgatga ggtcaccgtg        60
     acagttttag gggtgaaggg caaccaggta cgtattggcg tgaacgcccc gaaagaagtt       120
     tctgtccatc gtgaagagat ctaccagcgt atccaggctg aaaaatccca gcagtccagt       180
     tactaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page