(data stored in SCRATCH zone)

EMBL: CP000880.PE148

CP000880.PE148       Location/Qualifiers
FT   CDS_pept        143123..143548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00154"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1238 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20102"
FT                   /db_xref="GOA:A9MFZ4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ4"
FT                   /inference="similar to AA sequence:INSD:AAL21704.1"
FT                   /protein_id="ABX20102.1"
FT                   /translation="MSDGLSLLSLFASSFLSATLLPGNSEVVLVAMMVSGVSHPWILVL
FT                   TATMGNSLGGVTNVILGRFFPLRKTSRWQEKAAGWLKRYGAATLLLSWMPIIGDLLCLL
FT                   AGWMRIPWGRTIFFLCLGKALRYVALAAATIQGMMWW"
     gtgagtgacg gactgtcgct cctgtctctg tttgccagta gttttctcag cgcaacgctg        60
     ttacccggta attctgaagt tgttttggtt gccatgatgg tctcaggagt aagtcatccc       120
     tggatcttag tcttaacagc aacaatgggt aatagccttg gaggggtaac taacgttatt       180
     cttgggcgtt tctttccact gcgcaaaaca tcgcgctggc aagaaaaagc ggctggctgg       240
     ctaaagcgtt atggcgcagc cacactatta ttaagctgga tgccgataat cggtgatttg       300
     ttgtgcctgt tagcgggatg gatgcgcatc ccgtgggggc ggacgatctt ttttttgtgt       360
     cttggtaagg cgctgcgcta tgttgcgctc gcagcggcga cgattcaggg catgatgtgg       420
     tggtaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page