(data stored in SCRATCH zone)

EMBL: CP000880.PE15

CP000880.PE15        Location/Qualifiers
FT   CDS_pept        20594..22306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2947 1.8e-299 cysI; sulfite reductase,
FT                   alpha subunit, NADPH dependent K00381; COG: COG0155 Sulfite
FT                   reductase, beta subunit (hemoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19969"
FT                   /db_xref="GOA:A9MF17"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF17"
FT                   /inference="protein motif:HMMPfam:IPR005117"
FT                   /inference="protein motif:HMMPfam:IPR006067"
FT                   /inference="protein motif:HMMPIR:IPR008287"
FT                   /inference="protein motif:HMMTigr:IPR011786"
FT                   /inference="protein motif:ScanRegExp:IPR006066"
FT                   /inference="protein motif:superfamily:IPR011255"
FT                   /inference="similar to AA sequence:SwissProt:P17845"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX19969.1"
FT                   /translation="MSEKHPGPLVVEGKLSDAERMKRESNYLRGTIAEDLNDGLTGGFK
FT                   GDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQVIDKFAA
FT                   DNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYE
FT                   SQLHSEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVI
FT                   PPQNDIDLHANDMSFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGFLPLEH
FT                   TLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGLETFKAEVERRAGITFEPIRPYEFT
FT                   GRGDRIGWVKGIDDNWHLTLFIENGRILDYPGRPLKSGLLEIAKIHQGEFRITANQNLI
FT                   VASVPESQKMKVEKLALDYGLMNAVSPQRENSMACVSFPTCPLAMAEAERFLPSFVDKV
FT                   EAVMAKHGVGNEHIVLRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNRIGSRIPRM
FT                   YKENITEPAILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDFWE"
     atgagcgaaa aacatccagg cccactggtg gtcgaaggta aactgtccga tgccgagcgc        60
     atgaagcggg aaagcaacta cctgcgcggt accattgcgg aagatctgaa cgacggtctc       120
     accggcggtt ttaaaggcga taacttcctg ctgatccgct ttcacggcat gtatcagcag       180
     gatgatcgcg atattcgtgc agaacgtgct gaacagaagc tggagccgcg ccatgcgatg       240
     ctgctgcgct gccgtttgcc gggcggtgtc atcaccacta aacagtggca agtgatcgat       300
     aaatttgctg ctgataatac gatttacggc agtatccgcc tgaccaaccg tcagactttc       360
     cagtttcacg gcattctgaa gaagaacgtt aagccggtac atcagatgct gcactccgtc       420
     gggctggatg cgctggcgac tgccaatgac atgaaccgta acgtgctgtg tacttctaac       480
     ccgtatgaat cacagctaca ttccgaagcc tacgagtggg cgaagaagat ctcggaacat       540
     ctgctgccgc gcacccgcgc ctacgcggag atctggctcg atcaggaaaa agtcgccact       600
     actgatgaag aaccgatcct cggccagacc tatctgccgc gtaaattcaa gaccacggtg       660
     gtgattccgc cgcaaaacga tatcgatcta cacgccaacg atatgagctt tgtggcgatt       720
     gccgaaaacg gcaagctggt gggctttaac ctgctggtgg gcggtggtct gtctattgag       780
     cacggtaata aaaaaaccta cgcccgcacg gcgagtgaat tcggcttcct gccgctggag       840
     cacacgctgg cggtggcgga agcggtagtg accacacagc gcgactgggg taaccgtacc       900
     gacaggaaaa acgccaaaac caaatacacc cttgagcgcg tggggctgga gacgtttaaa       960
     gcagaagttg agcgtcgcgc ggggatcaca tttgaaccca ttcgtccgta tgaatttacc      1020
     gggcgtggcg acaggatagg ctgggtgaaa ggcattgatg ataactggca cctgacgctg      1080
     tttatcgaga atggccgtat tctggattac cctgggcgtc cactgaaaag cggtctgctg      1140
     gagatcgcga agattcatca gggcgagttc cgtattactg ctaaccagaa cctgattgtt      1200
     gccagcgtgc cggaaagcca gaaaatgaag gtagagaagc tggcgcttga ctacggcctg      1260
     atgaacgccg tgtcgccgca gcgtgaaaac tcaatggcct gcgtctcttt tccgacctgt      1320
     ccgttagcga tggccgaggc ggaacgcttc ctgccgtcgt tcgtcgataa ggtggaagcg      1380
     gtgatggcca aacatggcgt gggcaatgaa catatcgttc tgcgggtgac cggatgcccg      1440
     aacggctgcg gccgcgcgat gctggcggaa attggcttag tcgggaaagc gcccggtcgt      1500
     tataacttgc atcttggcgg caaccgcatc gggagccgta ttccacggat gtataaagaa      1560
     aatatcaccg agccggctat tttggcctcg ctggatgaac tgattgggcg ctgggcgaaa      1620
     gagcgcgaag cgggtgaagg tttcggtgac tttacggtgc gtgcgggaat tattcgtccg      1680
     gtgctcgatc ctgcgcgtga tttctgggaa tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page