(data stored in SCRATCH zone)

EMBL: CP000880.PE154

CP000880.PE154       Location/Qualifiers
FT   CDS_pept        complement(149858..151042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_1692 6.3e-17 Xaa-His dipeptidase
FT                   K01270; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20108"
FT                   /db_xref="GOA:A9MG00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG00"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151845.1"
FT                   /protein_id="ABX20108.1"
FT                   /translation="MTKPTHGLSPALIVLMSVATGLAVASNYYAQPLLDTIAHHFSLSA
FT                   SSAGFIVTAAQLGYAAGLLFLVPLGDMFERRTLIVSMTLLAAGGMLITASSQSLSMMIL
FT                   GTALTGLFSVVAQILVPLAATLATPATRGKVVGTIMSGLLLGILLARTVAGLLANLGGW
FT                   RTVFWLASALMALMAVALWRGLPKLKSDTHLNYPQLLGSVFSLFIHDKLLRTRALLGCL
FT                   TFANFSILWTSMAFLLAAPPFNYSEGMIGLFGLAGAAGALGARPAGGFVDKGKSHLTTT
FT                   VGLLLLLLSWLAIWLGHTSVLALIIGILVLDLTVQGVHITNQTVIYRLHPDARNRLTAG
FT                   YMTSYFIGGAAGSLISASAWQHAGWIGVCLAGVTVALFNLLIWWRGFHRQEAVN"
     atgacaaaac ccactcatgg gcttagcccg gcgctgatcg ttttaatgtc tgtggccacc        60
     ggtctggcgg tcgccagcaa ctattacgcc cagccgctgc ttgataccat cgcgcatcac       120
     ttttcgcttt ccgccagctc cgcagggttt atcgttaccg ccgcgcaact gggctatgcc       180
     gctggcctgt tgtttctggt gccgctcggc gacatgtttg aacgccgaac gctgattgtc       240
     tctatgacat tgctggcggc aggcggaatg ctgattaccg ccagtagtca gtcgcttagc       300
     atgatgatcc tcggaacggc tttaaccgga ctgttttccg tggtagcgca gattctggtt       360
     ccgctggccg ccacgcttgc gacgcccgcc acccgcggta aagtagtcgg caccattatg       420
     agcggcctgc tgctggggat cttgctggcg cgaacggtcg ccggactgct ggcaaacctc       480
     gggggttggc gcactgtatt ttggctagcg tcggcgctga tggcgctgat ggccgtcgcg       540
     ttgtggcgcg ggctgccaaa gctcaaatcc gacactcatc ttaactaccc gcaactgttg       600
     ggttctgtat tcagcctgtt tattcacgat aaattgctgc gtacccgcgc actactgggc       660
     tgtctgacct ttgctaattt cagtattctc tggacgtcga tggccttctt gctcgccgcg       720
     ccgccgttta actactccga ggggatgatt ggcctgtttg gcctggccgg tgccgccggc       780
     gctttgggcg cgcgtcctgc tggcggattt gtcgataaag gcaaatctca tctcactacc       840
     acggtcggat tactgttgct gttactctcc tggctggcca tctggcttgg gcacacctcg       900
     gtgctggcgc tgattattgg cattctggta ctggatctca cggttcaggg tgtacatatc       960
     accaatcaaa ccgtcattta tcgcttgcac ccggatgcgc gtaaccggct taccgccggc      1020
     tatatgacca gttactttat cggcggcgca gcgggttcgc taatttccgc ctccgcctgg      1080
     caacatgccg gttggatcgg cgtttgtctg gcgggtgtca cggtagccct atttaattta      1140
     ctgatctggt ggcgaggttt tcaccgacag gaagccgtaa attaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page