(data stored in SCRATCH zone)

EMBL: CP000880.PE184

CP000880.PE184       Location/Qualifiers
FT   CDS_pept        174817..176232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2784 1.7e-241 tctE; tricarboxylic
FT                   transport: regulatory protein K07649; COG: COG0642 Signal
FT                   transduction histidine kinase; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20138"
FT                   /db_xref="GOA:A9MG30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG30"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMPfam:IPR013727"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="similar to AA sequence:INSD:AAL21669.1"
FT                   /protein_id="ABX20138.1"
FT                   /translation="MKWVKPQSLYLQLLLFLGLPLILLWGLSTFNSYVNALQAATQAYD
FT                   RTLLSSARTVSERLVVRNSHLEVNVPWVVLDSFELNMNDRLYYKVVAPSGKVISGYADL
FT                   PAMPPATPRTRLYPALAWFYHTEYRGEAIRVARLLQPVNEGGIIGMAEIYVAETLQSRR
FT                   YLAGQLLFSSWISQGLLVLLTLVLVGWLLRRILRPMRQLSSLMVRREPGLLTPLPELLP
FT                   WSETRLLIVAFNRYIDRLRGILSRQERFSADASHQLKTPLAVLKTQAAVALASQQPRHW
FT                   YESLEAMSVTLDSTIQLTERLLQLSAVKHKEQGERRFSPVNLYDVVQNGCFTRLAQARS
FT                   KHTDLGYEGEQEAVWIDGDEVLLGELCGNLLDNALKYTPEQGIVTVRLERDGDVITLVV
FT                   EDSGPGIDDEHIHLALQPFHRLDNVGNVAGAGIGLALVNDIARLHRTHPHFSRSETLGG
FT                   LYVRIRFLSIVPQ"
     atgaagtggg ttaagccaca atcgttgtac ctgcaactct tgctgttcct ggggctaccg        60
     ctgattctgc tgtgggggct gtcgacattt aacagctatg tcaatgcgct acaggccgcc       120
     acacaggctt atgatcgtac actgctctct tcggcgcgaa cggtatcgga acggctggtg       180
     gtgcgtaata gccatctgga agttaacgtg ccgtgggtgg tgctggatag cttcgaactc       240
     aatatgaatg atcggctcta ttacaaagtc gtggcccctt ccggaaaggt gatatccggt       300
     tatgccgacc tgcccgccat gccgcccgct acgccccgta cccggcttta tccggcacta       360
     gcgtggttct atcataccga gtatcgcggc gaggcgatcc gtgtggcgcg tttgttacag       420
     ccggtgaatg aaggcggcat tatcggcatg gcggagattt atgtcgcaga gacgctacag       480
     tcccgtcgtt atctggcggg acagttgcta ttctcttcct ggatctcaca gggcctgctg       540
     gtgttgctga ccctggtgct ggttggctgg ttattacgcc ggatactgcg gcctatgcgt       600
     caactttcgt cattaatggt acgccgtgaa ccgggtctgc taacgccgct gccggaactg       660
     ctgccgtggt cggaaactcg cttgttaatc gtggcgttca atcgctatat tgacaggctc       720
     cgtggcatcc tctcccgcca ggaacgcttt agcgccgacg cttctcacca gttaaaaacg       780
     cctttggcgg tgttaaaaac gcaggcggcg gtggcgttag ccagccagca acctcgccac       840
     tggtatgaaa gtctggaggc gatgagcgta acgctggata gcaccattca gctcacggaa       900
     aggttgctgc aactttccgc ggtaaagcat aaagagcagg gtgagcggcg attctcgcca       960
     gtgaatttgt atgatgtcgt ccaaaatgga tgctttaccc gtctggcgca ggcgcgcagt      1020
     aaacatactg acctgggcta cgaaggcgaa caggaggcgg tgtggatcga cggggatgag      1080
     gtactgcttg gcgagctgtg cggaaacttg ctggataatg cgctgaaata cacgcccgag      1140
     caaggaatcg tcaccgtgcg tcttgaacgg gatggcgatg tcataacgct ggttgtcgaa      1200
     gatagcggcc ccggcattga tgatgagcat atccatctgg cgctgcagcc tttccaccgg      1260
     ctcgataacg taggaaatgt ggccggagcg ggcatcggtc tggcattggt caatgatatt      1320
     gcgcgcctgc accgtactca tccccatttt tcccgtagcg aaacgctggg agggttatat      1380
     gtaaggatac gctttttaag cattgttccg cagtga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page