(data stored in SCRATCH zone)

EMBL: CP000880.PE186

CP000880.PE186       Location/Qualifiers
FT   CDS_pept        complement(178098..178994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00193"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG11449 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20140"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG32"
FT                   /inference="protein motif:HMMPfam:IPR009977"
FT                   /inference="similar to AA sequence:INSD:AAO70247.1"
FT                   /protein_id="ABX20140.1"
FT                   /translation="MKIQEVKRILTRWELSSFSLYREAFTQYGGSINMHPDIVDYFMRR
FT                   HNWHFKFFHYKEDNAIKGAYFICNDQNIGILTRRTFPLSSDEILIPMAPELRCFLPDRT
FT                   NRLSVLHQPQILNAIWKITRKKQNCLVKETFSSKFEKRRRNEYQKFLRNGGSVRTVDEL
FT                   STEELAHTFITLFQSRFGDTLSGYPIENLIDFFTQLRHLLFGNILYIEGTPCAFDIVLK
FT                   SESRLNIYFDVPNSGVKSEYMKLSPGSILMWLNINRARHYCQERQKRLIFSLGILKPEW
FT                   EYKRLWSTPYFTGKSIC"
     gtgaaaatac aagaagtcaa acgtatatta acccgctggg agctgtcttc cttttcccta        60
     taccgggagg cgtttacgca atatggtggt agtatcaata tgcacccaga tattgtcgat       120
     tattttatga gacgccataa ttggcatttt aaattcttcc actataaaga ggataatgcg       180
     attaaaggcg catactttat ctgtaatgat cagaatattg gcatcctgac gcgcagaacc       240
     ttcccactat cttcagatga gatacttatt ccgatggcac ctgaattacg ctgcttctta       300
     cccgatcgta ctaaccggct ttcggtgtta catcagccac aaattctcaa tgcaatatgg       360
     aaaattacca gaaagaaaca aaactgtctg gtcaaagaaa cgttctcttc aaaattcgag       420
     aaaaggcgcc gtaatgaata ccaaaaattc ctgagaaacg gaggaagcgt cagaacggta       480
     gatgagcttt ctacagaaga gttggcgcac acctttatca cattgttcca gtcacgcttc       540
     ggcgacacgc taagcggtta tcccattgaa aatttaatag atttttttac ccagttgcgt       600
     caccttctgt tcggtaacat tctttatatt gagggtaccc cctgtgcgtt tgatattgtt       660
     ctgaagtctg aaagccgtct gaacatttac tttgatgtcc cgaatagcgg tgtaaaaagt       720
     gaatacatga agcttagccc tggcagcata ctaatgtggc tgaatattaa ccgcgccaga       780
     cattactgtc aggaaagaca aaaaagatta attttttctc tcggtatcct gaaacctgaa       840
     tgggaatata aacgcctgtg gtcgactccc tattttaccg gaaaatcaat ttgttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page