(data stored in SCRATCH zone)

EMBL: CP000880.PE189

CP000880.PE189       Location/Qualifiers
FT   CDS_pept        180671..181726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr3268 4.1e-09 serine/threonine kinase
FT                   K08884; COG: COG1357 Uncharacterized low-complexity
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20143"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG35"
FT                   /inference="protein motif:HMMPfam:IPR001646"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217697.1"
FT                   /protein_id="ABX20143.1"
FT                   /translation="MERSPDSLAGMAASAFGTGTYAAMRQATSLQSFLEFIINFFTCGG
FT                   VQRRNKRQYQELIEAMAETLRNSMCDRRNAPLPENIILDSVGGFCVEFNLPGANNDTGN
FT                   VIVRVCKDGNTETREVPMETFEKVCRVLLFRCEYSLPQDSIILTAQGGMYLKDALLTGA
FT                   NLTAENLCGADLSGANLEGAVLFMADCEGANFKGANLSGASLGDSNFKNACLEDSIMCG
FT                   ATLDHANLTGANLQHASLLGCSMIDSNLCGANMERANVSGAILTGANMCDTILKGTNMM
FT                   ATNMEGAILTRANLQKANLTSANLEGADLSQADLKNTNIKDCTLTHSRTEETRMSASTQ
FT                   MLFNEFYSDDF"
     atggaacgtt cacccgatag tctggctggt atggctgcat ctgcttttgg tacggggact        60
     tatgccgcta tgcggcaagc aacctctctc caaagttttc tggagtttat aattaacttt       120
     tttacctgtg gaggggtgca gcggagaaat aaaagacaat atcaggagtt gatcgaggct       180
     atggctgaga cattgaggaa ttcaatgtgt gatcgaagaa atgctccttt gccagaaaat       240
     attatattag atagtgttgg tggattttgc gtcgaattta atcttcctgg cgctaataac       300
     gacaccggaa atgttattgt acgtgtttgt aaagacggca atactgagac gagagaagtt       360
     ccgatggaaa cttttgaaaa agtctgtcgt gttttactat tcagatgtga gtattctctc       420
     cctcaggatt ctattatctt aactgcccag ggcggaatgt atctgaaaga tgcgcttctt       480
     accggagcaa atctgacggc agaaaattta tgtggtgcag acctaagcgg cgcaaattta       540
     gagggggcag tgctgtttat ggcggattgc gaaggggcaa attttaaggg cgctaatcta       600
     tcgggagcat cattaggcga cagtaatttc aagaacgcct gtctggaaga tagcattatg       660
     tgtggcgcta ccctcgatca cgctaatctt actggcgcca atttacaaca cgcgagtctg       720
     ttaggctgta gcatgataga cagtaatctc tgcggagcga atatggaacg tgccaatgtt       780
     tcaggcgcga ttcttactgg tgccaatatg tgtgatacga tattaaaagg tactaatatg       840
     atggccacta atatggaggg tgccatctta acccgggcaa acctgcaaaa ggctaattta       900
     acctcggcga accttgaagg agctgacttg tctcaggctg atttaaaaaa taccaatatt       960
     aaagattgta cgctaaccca ttcacgtacc gaagaaacca gaatgtctgc aagtacacaa      1020
     atgctcttta acgaatttta tagtgatgat ttttag                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page