(data stored in SCRATCH zone)

EMBL: CP000880.PE205

CP000880.PE205       Location/Qualifiers
FT   CDS_pept        195665..197701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:68.t00029 3.5e-07 protein phosphatase with
FT                   leucine-rich repeats K01768; COG: COG4886 Leucine-rich
FT                   repeat (LRR) protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20159"
FT                   /db_xref="GOA:A9MG51"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG51"
FT                   /inference="similar to AA sequence:INSD:AAD40326.1"
FT                   /protein_id="ABX20159.1"
FT                   /translation="MSSWEKCKEFFCSTHQTEALECIRTICHPPAGTTREDVVSRFEQL
FT                   RTLAYAGCEENIHSGLHGENHFCIMDEDNQEILSVTLDDAGNYTVNCQGYSETHHFTMA
FT                   TEPGVERTEHAEGASGTSCLPATTAPQTAAEYDAVWSAWQRAAPKGEARGRAAVVQEMR
FT                   DCLKNGNPVLNVGGAGLTTLPDHLPPHITKLIIPRNNYLTRLSRLPPGLRELSVDGNLL
FT                   ASLPALPPGLQSLSVPGNQLPSLPDLPSGLRKLWASGNRLTSLSALPSGLRELIISSNR
FT                   LTSLPALPSELRELSVSHNLLPSLPELPSGLQELSVSHNRLTRLPESIISLPSYARVNL
FT                   DGNPLSERTLRTLRNLTSAPGYSGPRIRFDMAGPSVPREARALHLAVADWLMPAREGEP
FT                   DPADRWHASGQEDNAAAFSLFLDRLSETENFEKDAGFKAQISSWLALLAEDDVLRAKTF
FT                   AMATEATSSCEDRVTFALHQMKNVQLVHNAEKGVYDNNLPGLVSTGREMFRMEMLERIA
FT                   LEKVRTLAFVDEIEVCLAYQNKLKESLELTSVTAEMRFFGASGVTTSDLRSAERQVKAA
FT                   ENSEFSEWLLQWGPLHSVLERKEPERFNALREKQISDYEHTYQMLSDTELKPSGLVGNT
FT                   DAERTIGVRAMESAKKEFLNGLRPLVEEMLGSYLKVKARRRLN"
     atgagctcct gggaaaaatg taaggaattt ttttgctcaa cgcatcagac tgaagcgctg        60
     gagtgcatcc ggacgatttg tcacccgccg gccggaacga cgcgggagga tgtggtcagc       120
     agatttgaac agctcaggac gctcgcgtat gccggatgcg aggaaaacat tcattccggc       180
     ctgcacgggg aaaaccactt ctgtatcatg gatgaagaca accaggagat attatcagtc       240
     accctggacg acgccgggaa ctataccgtg aattgccagg ggtacagtga aacacatcac       300
     ttcaccatgg caacagaacc gggagtggaa cgcacagaac acgcggaagg ggcatccggg       360
     acatcctgcc tccctgccac aacggcgcca cagacggcag cagagtatga tgctgtctgg       420
     tcagcatggc aaagggcggc gccaaaagga gaggcacgcg gccgcgcagc agtggtacag       480
     gaaatgcgcg actgcctgaa gaacggcaat ccagtgctta acgtgggggg ggcaggtctt       540
     accactttac cagaccattt accaccgcat attacaaaat tgattattcc tcgtaataat       600
     tatctgaccc gcctgtcgag gttgccgcca ggactacggg agctgtcggt agatggtaat       660
     ctgctggcca gcctgccggc gctgccgcca ggactacagt cgctgtcggt ccctggtaac       720
     caactgccca gcctgccgga tctgccgtca ggactacgta aactgtgggc ctctggtaac       780
     cgactgacca gcctgtcggc gctgccgtca ggactacggg agctgattat ttctagtaac       840
     cgactgacca gcctgccggc gctgccgtca gaactacggg agctgtcggt ctctcataac       900
     ctgctgccca gcctgccgga gctgccgtca ggactacagg aactgtcggt ctctcataac       960
     cggctgaccc gcctgccgga aagcatcatt agtctgccct catacgcaag agtaaatctg      1020
     gatgggaatc cgctgtctga acgcactctg cggactctgc ggaacctaac cagcgctcct      1080
     ggctattcag gccccaggat acgattcgat atggcggggc cttccgtccc ccgggaagcc      1140
     cgggcactgc acctggcggt cgctgactgg ctgatgcctg cacgggaggg ggaaccggac      1200
     cctgcagaca gatggcatgc gtccggacag gaggataacg ccgccgcctt cagcctcttc      1260
     ctggacagac tgagtgagac ggaaaacttc gaaaaggacg cgggctttaa ggcacagata      1320
     tcgtcctggc tggccctgct ggctgaagat gatgtgctga gagcaaaaac ctttgccatg      1380
     gcaaccgagg caacatcaag ctgcgaggac cgggtcacgt ttgctttgca ccagatgaag      1440
     aacgtacagc tggtacataa tgcagaaaaa ggagtatacg ataacaatct cccggggctg      1500
     gtttccacgg ggcgtgagat gttccgtatg gaaatgctgg aacggattgc cctggaaaag      1560
     gtcagaacgc tggctttcgt tgatgaaatt gaggtctgtc tggcgtatca gaataagctg      1620
     aaggaatcac ttgaactcac cagcgtgacg gcagaaatgc gtttctttgg cgcgtccggc      1680
     gtgacgactt cagaccttcg gagcgctgag cgtcaggtga aagccgccga aaacagcgag      1740
     ttcagtgagt ggttactgca gtggggcccg ttgcacagcg tgctggaacg caaagagccg      1800
     gaacgcttta acgcgcttcg tgaaaagcaa atatcggact atgagcacac gtaccagatg      1860
     ctgtctgaca cagagctgaa accgtccggg ctggtcggta ataccgatgc agagcgcact      1920
     atcggagtaa gggcgatgga aagtgcgaaa aaggaatttc tgaatggcct gcgccctctt      1980
     gtggaggaga tgctgggtag ctatctgaaa gtgaaagccc ggcggcgtct taactga         2037
//

If you have problems or comments...

PBIL Back to PBIL home page