(data stored in SCRATCH zone)

EMBL: CP000880.PE212

CP000880.PE212       Location/Qualifiers
FT   CDS_pept        204775..205179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00219"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG17703 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20166"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ5"
FT                   /inference="similar to AA sequence:INSD:ABP61564.1"
FT                   /protein_id="ABX20166.1"
FT                   /translation="MKQEMHMAKHLNRSEIKAITHMILTWDGKITWSDLCESVYKNLNR
FT                   TITRQSLSAHDEVVEAYRTKKNLSNLKKSGLKKPANLTIAAQQILNLKAENEMLKKQNN
FT                   RYKEQFSYWQYNAYRHGLTMEQLNRPFNKK"
     ttgaaacagg agatgcatat ggcaaaacat ttaaacagga gtgaaataaa ggcaattaca        60
     cacatgatac tgacttggga cggcaaaatc acatggagtg atttatgtga atcagtttat       120
     aagaatttaa acagaactat cacaaggcaa tctttaagtg ctcatgatga agttgttgaa       180
     gcatatagaa caaagaaaaa tttatccaat ttgaaaaaat caggcttaaa gaaaccagct       240
     aatttaacaa ttgcggcaca acaaatatta aatcttaaag ccgaaaatga aatgttgaaa       300
     aaacagaaca atagatacaa agagcaattt agctattggc agtacaatgc ttacagacac       360
     ggtcttacta tggaacagtt gaataggcca tttaataaaa aataa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page