(data stored in SCRATCH zone)

EMBL: CP000880.PE216

CP000880.PE216       Location/Qualifiers
FT   CDS_pept        206504..206602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20170"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ9"
FT                   /protein_id="ABX20170.1"
FT                   /translation="MKLISPYKNNSVCIRSFDFIDKNNDAYEKRKD"
     gtgaaattaa tttcaccgta taaaaacaac tctgtctgca tacgttcttt tgattttata        60
     gataagaata atgatgctta tgaaaaacgt aaggactga                               99
//

If you have problems or comments...

PBIL Back to PBIL home page