(data stored in SCRATCH zone)

EMBL: CP000880.PE218

CP000880.PE218       Location/Qualifiers
FT   CDS_pept        complement(207012..208169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00225"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG10802 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20172"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR1"
FT                   /inference="protein motif:HMMPfam:IPR005094"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177613.1"
FT                   /protein_id="ABX20172.1"
FT                   /translation="MQKIKRGKSFAGVVQYALKPGSHHKSNPIVIGGNMLGDSASEVIA
FT                   EFDGTKQLRPDVQKAVWHNSLRLPSGESLTAEQWSSIADDYMKRMGFSDTHLRCYVLHD
FT                   DQAGQHVHIIASRIDLNGGKLYLGKNENLISTRIISELETRYGLIETAQHKKPRQVKRR
FT                   KISRNEEMLSRRTGIPSPKEALQQILDKSLADTPDLLTFIKRLQEAEVSWKANIASTGK
FT                   MNGFSFEYTGIAFKASQLGKGYSWANLQKQLNYNPDHLEALQTGIQTKEALPAHIPMPV
FT                   PVPVPVPVEQVARDTVRSESIGEKIAEIEMRLREDKRNEIVGKILQKNAVQRQKHLRFV
FT                   EWLASIKHYIELLRSFGKTILHKTHTTFSNIYAMKPSKKARKIRL"
     atgcagaaga tcaaaagggg taagagcttc gctggtgtcg ttcaatatgc attgaagcca        60
     ggttcacatc ataaaagtaa tccaatcgtc attggcggga acatgttagg tgattcagcc       120
     tctgaagtga tcgctgaatt tgatggcact aaacagcttc gcccagatgt tcagaaggcc       180
     gtttggcaca actcgcttcg gttgcctagt ggagaatccc taacggctga acaatggtcc       240
     agcatcgcag atgactatat gaagaggatg gggttcagtg atacacacct ccgttgctat       300
     gttcttcatg atgatcaggc tggtcagcac gtacacatta ttgcaagtcg catagatctc       360
     aatggcggga agctctactt aggcaagaat gagaacctta tcagcactcg aatcattagt       420
     gaactcgaaa ccaggtatgg tctcattgag acagcccagc ataaaaagcc aaggcaagta       480
     aagcggagaa aaatctcccg taatgaagag atgctatcca gaagaacagg cattccctcc       540
     cctaaagaag ctctccaaca gatacttgat aaaagtttgg cagatacacc tgacctttta       600
     acttttatca agaggctgca agaagctgaa gtatcctgga aggccaatat tgcctctacc       660
     ggtaaaatga acggcttctc tttcgaatac acaggaatag ctttcaaagc ttcacagtta       720
     ggcaagggtt actcctgggc aaatcttcaa aagcaactta actacaaccc cgaccactta       780
     gaagctcttc aaacgggcat acagaccaag gaagctctac ctgctcatat accaatgcct       840
     gtccctgtcc ctgtccctgt ccctgtagaa caggttgcca gagatactgt gcgaagcgaa       900
     agcataggcg aaaaaattgc tgaaatcgaa atgcgactca gagaagacaa acgaaacgaa       960
     atcgtaggaa agattcttca aaaaaatgca gtacaacggc aaaagcatct cagattcgta      1020
     gagtggcttg cttccataaa gcattacatt gagctcttga gaagctttgg taagaccatt      1080
     cttcacaaaa cacacacgac cttttcaaat atctacgcaa tgaaaccttc aaagaaggcg      1140
     agaaaaattc gtttatag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page