(data stored in SCRATCH zone)

EMBL: CP000880.PE220

CP000880.PE220       Location/Qualifiers
FT   CDS_pept        complement(208585..208752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20174"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR3"
FT                   /protein_id="ABX20174.1"
FT                   /translation="MTQLIKNSNINKNSLIRILIKFQFNYFVFFKASQPPLNTIMTLTL
FT                   KLNMLIKTII"
     atgacacaac tcataaaaaa ttcaaacatc aataagaaca gtcttattcg catcctcatt        60
     aaatttcaat ttaattattt tgtttttttt aaagcatcac aaccgccatt aaatacaatc       120
     atgaccttga ctttaaaatt aaacatgtta ataaaaacta tcatttga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page