(data stored in SCRATCH zone)

EMBL: CP000880.PE230

CP000880.PE230       Location/Qualifiers
FT   CDS_pept        complement(221852..233353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1906 3.9e-51 CHU large protein,
FT                   possible SAP or adhesin AidA-related K01238; COG: COG5295
FT                   Autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20184"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS3"
FT                   /inference="protein motif:superfamily:IPR008957"
FT                   /inference="protein motif:superfamily:IPR008964"
FT                   /inference="protein motif:superfamily:IPR008979"
FT                   /inference="protein motif:superfamily:IPR011048"
FT                   /inference="protein motif:superfamily:IPR011049"
FT                   /protein_id="ABX20184.1"
FT                   /translation="MRLLAVVSKLTGVSTTVESSAVTLNAPSIVKLSVARDEISQLTRI
FT                   NQDLMVTLHSGETITIKNFYVTNDLGASQLVLAESDGTLWWVENPQAGLHFEQIADINE
FT                   LLVTSGASHETGGAVWPWVLAGAVAAGGIAAIASSGGGDSHHSDSDNPLPDNTNPGGNP
FT                   PDNTNPDGNPPDNDNPGGTNPDGNNPDSSNPVDTTPPLAPSELLISADGKTVSGQAEAG
FT                   STITIKDPSGNVVGEGKTDSNGKFSIDLTTPHLSGEQLTVTATDDAGNTGPSATIDAPN
FT                   IPFPDTPIITAAIDNADPLTGTLSNNQFTNDSTPTLEGTGSAGAVIHIYANGQEIGTTT
FT                   VDASGNWRFSITNALTDGENRFTAIATNVKGESSESASFTLTIDTLSPDAPIVELITDN
FT                   TGLLTGPLQNNDRTDEAKPLFSGQGEPGNTITIKEGSTIIGSATVDENGRWTFMPTTPL
FT                   SNGEHTFTVEQSDQAGNVSRVTTTPTIIVDTTPPDAAAIDNVAKDGSTVSGTAEAGSTV
FT                   SIYDPAGNYLGSAITGDNNQFNITLNPAQTHGERLEARIQDAVGNIGPVTEFTASDSQY
FT                   PAQPIILTVTDDAGAVTGLLKNGDATDDNRPTLSGTAEPGSTISISDNGFPVPTFPLVV
FT                   ADADGKWSFTPSLALPDGDHVFTATATNDRGTSGQSVSFTIDIDTQPPVLENLAVSDIG
FT                   DKLTGATEAGSTVVIKDSQGNMLGSGTAGDDGTFSISISPAKINGETLSISVIDKAANS
FT                   GPVETLNAPDKTAPAAPNGLIVATDGLSVSGQAEAGSTVTIRDSSNTVLGSAVANGNGQ
FT                   FIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDSTAPEMPKDVVISEDGASISGTA
FT                   EPGSAITITTSDGTPLGSGKVDGEGHFTLPLVPAQTNGEQVTVTATDGANNVSPPATAQ
FT                   APDITAPDKPIISQVLDDVESFTGPLANGQTTNDSRPTLSGTAEAGARVEVFDNGVSLG
FT                   LATLQSNGSWTFTPLQNLSEGAHRLTVIATDAKGNASPAASFDLVVDTQSPQQPVITFI
FT                   TDDAPGMLGSIAHLGLTNDNTPTINGTGEPGSTVHLYQNGARIADIIVGSSGVWSYAYT
FT                   TASPLVDDTYTFTVTASDSNGNTTPFSTDFTITIDTLVPAAPGIISVADGDGNTIDTNQ
FT                   LTQESQPRLSGSGTAGDTIILYDNGNIIGQALVGADGRWQFTPPAALGDGTHLLTARAN
FT                   DPAGNESPESISFTLRVDTQAPDAPQIVSAAIAGGEGEVLLANGSITNQRMPTLSGTGE
FT                   PGAIITLYNNGAVLDTVQVNPQGSWTYPLTSNLSEGLNVLTAIAMDAAGNSSPTSGVFS
FT                   VTLDTLPPAQPDAPLISDNVAPVIGNIGNNGATNDTTPTFSGTGEIGSTIILYNNGSEI
FT                   GRTTVGDNGSWNFTPAALTPGTYIITVTETDVAGNISPPSASVTFAIDITAPANPVITF
FT                   AEDNVGDVQDNVASGATTDDNTPVIHGTGDIGSVITLYNGGNVLGVATVDETGTWTLPV
FT                   TSALPDGTYTLTAIAADAAGNSSGVSNSFTLTVDTVPLQPPVVSEILDDVAPVTGPLTD
FT                   GAFTNDRTLTINGSGENGSTVTIYDNGIEIGTALVSDGTWTFNTPVLSEASHALTFSAT
FT                   DGAGNTTAQTQPIIITIDVTAPPAPSIQTVADDGTRVAGLADPYATVEIRNADDILVGS
FT                   AVANATGEFAVTLSPAQTDGGTLTAIALDRAGNNGPATDFLASDSGLPAVPVITAIEDN
FT                   VGSVQGNIAAGGATDDATPTLRGTTDIGSTVEVFIDGDSAGFATVDASGNWIFEIATPL
FT                   SESAHSVTVQATNAKGQGGLSEPVRITIDLSAPAQPIITSATDDVPGVTGTLDNGALTN
FT                   DSRPTLNGTGEAGATIRILDNGVEIGSATVDQSGNWRFTPNAPLESNTHLFTAVATDPA
FT                   GNSGQPSDGFTLTIDALAPDVPVIISVIDDNNQPSIPVSPGQSTDDRQPILNGTGEPGA
FT                   TITIFDNGTPLGTTQVNESGSWSFPVTSNLSEGSHDLTVSATDPAGNTSAVSTPWTIVV
FT                   DITPPAIPVLTSVVDDRPGITGDLVSGQLTNDATPTLNGRGEAGATITVYLDGNPTPIG
FT                   TTTVNSDGTWSFTPQTPIANGNHTLTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIAS
FT                   VADNTAPVTGIVPNGGSTNETRPTLAGTGEAGSTISIYNGSALVGTAQVQANGSWSFTP
FT                   PTSLSAGVWNLTATATDAAGNTSVASETRTFTIDTTAPAAPVISTVYDGTGPITGNLSP
FT                   GQMTDEVRPVISGTREANTTIRLYDNGTLLAEIPADNSSSWRYTPDASLATGNHVITVI
FT                   AVDAAGNASPVSDSVNFVVDTTPPLAPVITSVSDDQAPGLGTIANGQSTNDPTPTFSGT
FT                   AEAGATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNGSPNSTAF
FT                   TLTVDTTAPQTPILTSVVDDVAGGATGNLANGQITNDNRPTLNGTAEAGSVVSIYDGGT
FT                   LLGVTTADAGGAWSFAPTTGLSDGTRTLTVTATDPAGNVSPVTDSFTIVVDTLAPTVPL
FT                   ITSIVDDVPNNTGAIGNGQSTNDTLPTLNGTAEANSTVSIFDNGALVATVTANANGNWS
FT                   WTPTTALGQGSHAYSVSAADAAGNVSAASQPTTIIVDTIAPGAPGNLTINATGNRVTGT
FT                   AEAGSTVTITTDTGVVLGTATADGTGSFSAALTPAQTNGQPLLAFAQDKAGNTGITAGF
FT                   TAPDTRVPEAPIITTVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATVSIYNNGALL
FT                   GTTTANASGNWSFTPAGNLTEGSHAFTATATNANGTGSVSTAATVIVDTQAPGTPSGTL
FT                   SADGGSLSGLAEANSTVTVTLAGGITLTTTAGSNGAWSLTLPTKQIEGQLINVTATDAA
FT                   GNASGTLGITAPILPLAARDNITSLDLTSTADTSTQNYSDYGLLLVGALGNVASVLGND
FT                   IAQVEFTIAEGGTGDVTIDAAATGIVLSLLSTQEIVVQRYDTSLGAWTTIVNTAVGDFA
FT                   NLLTLTGSGVTLNLSGLGEGQYRVLTYNTSLLATGSYTSLDVDVHQTSAGIISGPTMST
FT                   GNVMADDTAPTGTTVTAITNANGVSTPVGAGGVDIQGQYGTLHINQDGSYTYTLTNPTA
FT                   GYGHKESFTYTITQNGVGSSSAQLVINLGPAPVPGSVVATDNNASLVFDTHVSYVNNGP
FT                   STQSGVTVLSVGLGNVLNANLLDDMTNPIIFNVEEGATRTMTLQGTVGGVSLASSFDLY
FT                   VYRFNDAIQQYEQFRVQKGWINTLLLAGQSQPLTLTLPGGEYLFVLNTASGISVLTGYT
FT                   LTISQDHTYAVDSITTSTTGNVLTNDVAPADALLTEVNGVAISATGTTNVNGLYGTLTI
FT                   DAKGNYTYTLKNGVGADSIKTPDSFIYTVKAPNGDTDTASLNITPTARALDAINDVSDT
FT                   LSVATLQDTAAWLDSSVGSASWGLLGKSGSGSGTFDVATGTVLKGASLVFDVSTLITLG
FT                   NLNISWAILENGTVIRNGTVPVANITLGGATVTVNLSGLELDAGTYTLNFTGTNTLAGA
FT                   ATITPRVIGTTVDLDNFETSGTHTVLGNIFDGSDAAGAMDQLNTVNTRLNISGYNGSAS
FT                   TLDASTNTTSATIQGHYGTLQINLDGAYTYTLNNGIAISSITSKEVFTYQLDDKMGHTD
FT                   SATLTIDMVPQIVSTNQNDVLIGSAYGDTLIYHLLNGADATGGNGTDRWQNFSTAQGDK
FT                   IDIHELLTGWDHQAATLGNFVQVHTSGANTVISVDRDGAGSAFKSTDLVTLENVQLTLN
FT                   DLLQNNHLVIGG"
     atgcgtctac tcgccgtggt ttcaaaattg actggcgtct ccactactgt ggaatcctca        60
     gcggtcacgc ttaacgcccc ttcaattgtt aaattatcag tagcgcggga tgaaattagt       120
     caacttacgc gcattaacca ggatctgatg gtaacgcttc attccggcga aacaatcacg       180
     attaaaaact tttacgttac caacgatctg ggcgcaagcc agttggtatt ggcggaaagc       240
     gatggcacgt tatggtgggt agaaaatccg caagccgggc tacattttga acaaatcgcc       300
     gatattaacg agctgctggt cacttctggc gcttcccatg aaacaggagg cgccgtttgg       360
     ccgtgggtac tggctggcgc ggtagcggct ggcggcattg ccgctatcgc atcttccggc       420
     ggcggcgact ctcatcattc ggatagtgat aatccgctcc ccgataacac caatcctggc       480
     ggtaatcccc ccgataatac caatcctgac ggaaatcccc ccgataacga caatcctggc       540
     ggtactaacc ccgacggcaa taatccggat agcagtaatc ctgtagatac tacaccgcct       600
     ctcgctccca gcgaattatt aatttcagcg gacggaaaaa cggtgagcgg ccaagccgaa       660
     gcgggcagta ccattacgat caaagatcct tcaggcaacg tcgttggcga gggcaaaacg       720
     gatagcaacg gtaaatttag tattgatctg acgacaccgc accttagcgg cgaacagctg       780
     accgttaccg cgactgacga tgccggcaat acaggcccat ccgcaacgat cgatgcgccc       840
     aacattcctt tccccgatac accgattatc accgccgcta tcgacaatgc cgatccactc       900
     accggcacac ttagcaataa tcagtttacg aacgacagca cccccaccct ggaaggaacg       960
     ggcagcgcag gcgccgtcat ccatatttac gccaatggtc aggagatagg tacaacaacg      1020
     gttgatgcca gcggaaattg gcgtttttcc attaccaacg cgctaacgga cggggaaaat      1080
     cgtttcaccg ccattgcgac taatgttaaa ggcgaaagta gcgaatcagc cagctttacg      1140
     ctgactatcg acacactcag ccccgatgcc ccaatcgttg aactgattac cgataacacc      1200
     ggtttgctca ccgggccgct acagaataat gaccgaactg acgaggcaaa accactattt      1260
     tccggacagg gagagccagg caataccatc accattaaag aggggtcaac cattatcggc      1320
     agcgctaccg tagacgaaaa tgggcgctgg acctttatgc cgactacgcc gttaagcaat      1380
     ggcgaacaca catttaccgt cgaacagagc gaccaggctg gaaacgtgag tcgcgtgacg      1440
     acaacgccta ctatcattgt cgacaccacg ccccctgacg ccgctgctat tgataatgtc      1500
     gccaaagacg gctcaaccgt tagcggtacc gctgaggctg gcagtactgt gtcgatatat      1560
     gacccggcag gaaattacct gggttctgcg attaccggag ataataacca attcaacatc      1620
     acgctgaatc cggcccagac ccacggcgag cgtctggaag cgcgtattca ggacgccgtc      1680
     ggcaatatcg gtcccgtcac ggaatttacc gcttctgact cacagtatcc cgcccagccg      1740
     attatcctta ccgtgacaga cgacgctggc gccgttaccg gactgttaaa aaatggcgat      1800
     gccacggatg ataaccgccc gaccctcagc ggtactgctg aaccaggcag tacgatatcg      1860
     attagcgata acggctttcc tgtacccacc tttccccttg ttgtcgctga cgctgacggc      1920
     aaatggagct ttaccccctc gcttgcgctt cctgatggcg accatgtctt taccgctacc      1980
     gccacaaacg atcgcggcac cagcggacag tccgtctcct ttaccattga tatcgacacg      2040
     cagccaccgg tgctggaaaa cctggcggtt agcgatatcg gcgacaaact caccggcgcc      2100
     acggaagcag gtagtactgt ggttatcaaa gatagtcagg gaaatatgct cggtagcgga      2160
     acggcaggcg atgacggtac cttctcaata agcattagcc cggcgaaaat caacggcgaa      2220
     acattaagca ttagcgttat cgataaagcc gcgaatagcg gtccggtaga aaccctgaac      2280
     gcgccggata aaactgcgcc tgcggcccca aacggtctta tcgtggcgac cgatggcctg      2340
     tccgtaagcg gtcaggcgga agccgggtca acggtcacta tccgcgatag tagcaatacc      2400
     gtactcggca gcgccgtcgc taacggcaac ggacaattta tcgttccgct gaataccgcg      2460
     caaactaacg gtcaggcgct tatcgctacc gccaccgatg tagcgaaaaa cgaaagcgcc      2520
     gccgcaacgg tcatcgcgcc ggacagcacg gcgccggaaa tgccgaaaga cgtggtgatt      2580
     agcgaggatg gcgccagcat cagcggcacc gccgaaccgg gcagcgccat tacgatcacg      2640
     acatcggacg gcacgccgct tggtagcggc aaggtagacg gcgaaggtca ctttacactt      2700
     cctctcgtcc ccgcccagac gaacggcgaa caggttaccg ttaccgccac cgacggcgcc      2760
     aataacgtca gcccaccagc aacagcacaa gcgccagata tcaccgcccc ggataagccc      2820
     attatttctc aggtgctgga cgacgttgaa agctttaccg ggccgctggc taacggacaa      2880
     accaccaacg acagccgccc cacccttagc ggtacggcgg aagccggagc acgtgtcgaa      2940
     gtctttgata acggcgtttc gctgggactc gccacgctac agtccaacgg cagttggacg      3000
     tttacgccgt tgcaaaattt aagcgaaggc gcgcatcgac tgaccgtaat cgcaaccgat      3060
     gcgaaaggca atgcaagccc ggccgcttca ttcgatctgg tggtcgatac gcaatcgccg      3120
     cagcagccgg taatcacctt cattacagat gatgcgccag gtatgctcgg tagcatcgcg      3180
     catctggggc tgactaacga caacacccca acgattaacg gtacaggcga accgggttca      3240
     acggtacacc tgtatcagaa tggcgctcgg atagccgata ttatcgtcgg tagttccggc      3300
     gtctggagct acgcctacac caccgcctca ccactggtgg acgataccta tacctttacc      3360
     gtaacggcca gcgacagtaa cggcaacacc acgccttttt cgaccgattt tacgattacc      3420
     attgataccc tggtccctgc cgcgcccggc atcatcagcg tggctgacgg cgatggaaat      3480
     acgattgata ccaatcagtt aacccaggaa tcccagccac gcctgagcgg tagcggcacc      3540
     gcaggcgaca ctatcatcct ttacgataac ggcaatatca taggtcaggc gctggtcggc      3600
     gcggacggtc gctggcagtt tacgccgcct gccgcgctgg gcgacggcac ccaccttctg      3660
     accgctcgcg ccaacgatcc ggcggggaac gaaagtcccg aatccatcag ctttaccctg      3720
     cgcgtcgata cccaggcgcc ggatgcgccg cagatcgtgt cagccgctat cgcaggcgga      3780
     gaaggcgagg tgttgctggc aaacggcagt attaccaatc agcgtatgcc gaccctcagc      3840
     ggcaccggcg aacccggcgc catcatcacc ctgtacaaca acggcgctgt actggatacc      3900
     gtccaggtca atccacaggg tagctggacc tatccgctaa ccagtaatct gagcgaaggg      3960
     ttaaacgtac tgacggccat cgccatggat gccgcgggca atagcagccc gacctccggc      4020
     gtcttctctg tcacgcttga taccttgcct ccagcgcagc ctgacgcgcc gctgatcagc      4080
     gataacgtcg cgccggttat cggcaatatc ggcaataatg gcgcaacgaa cgacaccacg      4140
     ccgaccttca gcggcacggg agagatcggc agcacgatta ttctctacaa taatggcagt      4200
     gaaattggcc gcacaacggt aggcgataac ggtagctgga actttacgcc tgcggcactg      4260
     acgccgggaa cctatatcat taccgttacg gaaaccgatg tagcgggcaa tatcagcccc      4320
     ccttccgcct cagtcacttt tgcaatagac attactgcgc cagcgaatcc ggttatcact      4380
     tttgccgaag ataacgtcgg cgatgtacag gataacgttg ctagcggcgc aaccactgac      4440
     gacaatacgc cagtcattca cggcaccggc gacatcggca gcgttatcac gctctataat      4500
     ggcggcaacg ttttgggcgt ggccaccgtc gatgagaccg gcacctggac gttgcctgtg      4560
     accagcgcat tgccggatgg cacctacacc ctgactgcca ttgccgctga cgccgccgga      4620
     aacagcagcg gcgtatcgaa cagctttacc cttaccgtcg ataccgttcc gttgcagccg      4680
     cccgtcgtca gtgaaatcct cgacgatgtt gcgccagtaa ccgggccatt aaccgatggc      4740
     gcctttacta acgatcggac gctgactatc aacggcagcg gcgaaaacgg cagcaccgtc      4800
     acgatttacg acaatggcat agaaatcggt acggcgctcg tcagcgacgg aacttggaca      4860
     ttcaatactc cagtattgtc agaagccagt catgcgctaa ccttcagcgc aactgacggc      4920
     gcaggaaata ccacggcgca aactcaaccg atcatcatca ccatcgatgt caccgccccg      4980
     cccgccccgt cgatccagac ggttgcagac gatggtacgc gcgtcgctgg acttgccgat      5040
     ccttacgcta ccgttgaaat tcgtaatgcc gatgacatcc tcgtcggcag cgctgtcgct      5100
     aatgccaccg gtgaattcgc cgtcacgctc agtccagcgc aaaccgatgg cggaacgctg      5160
     acggcaatcg ctctcgatcg cgcggggaat aacggcccgg caacggattt cctcgcctcc      5220
     gacagcggtc tgcctgccgt gccggtcatc acggcgattg aagataatgt cggaagcgtt      5280
     caggggaata tcgcagcggg cggcgctacg gacgacgcca cgccgacgct gcgcggaacc      5340
     acagatatcg gttctaccgt tgaagtcttc atcgatggcg attcggcagg cttcgccacc      5400
     gttgatgcta gcgggaactg gatctttgag atcgccacgc cattaagtga aagcgcacat      5460
     agcgtcactg tccaggccac caatgcgaaa ggccagggcg gtctgtccga accggtcagg      5520
     atcactatcg atcttagcgc gccggcgcaa ccgatcatta ccagcgcaac ggatgatgtc      5580
     cccggcgtga ccggtacgct ggataacggc gcgctcacca atgattcgcg cccgacgctc      5640
     aacgggacgg gagaagcagg cgccacgatc cgcattctgg ataacggcgt agaaatcggt      5700
     tccgctacgg tagatcaaag cggtaactgg cgcttcaccc cgaacgcgcc gctggagagc      5760
     aacacgcatc tcttcactgc tgtggcgacc gaccccgccg gaaatagcgg ccagccttca      5820
     gacggcttta cactgaccat tgacgccctg gcgccagatg taccagtcat catttctgtg      5880
     attgacgata acaatcagcc gtccattccg gtctcaccgg gacagtcaac cgacgatcgg      5940
     cagccgatac tgaacgggac tggcgaacct ggcgcgacga tcactatttt tgacaatggt      6000
     acgccgcttg gtacgactca ggtaaacgaa agcggtagct ggtccttccc ggtgaccagc      6060
     aatttgtcag agggaagcca tgatctgacg gttagcgcta ccgatccggc gggcaatacc      6120
     agcgcggtct ccacgccgtg gacgatcgtg gtcgatatta cgcctccggc gatcccggtt      6180
     ctcacctctg ttgtggatga ccggcccggt attaccggcg acctggtcag cgggcagcta      6240
     acgaacgatg cgacgcccac cctgaacgga cgcggggagg caggcgcgac gattactgtc      6300
     tatcttgacg gtaatccaac gcccatcggt acaacgacag tgaatagcga tggtacatgg      6360
     agtttcacgc cgcagacgcc gattgcaaac ggcaaccata cgctcaccct tagcgccacc      6420
     gatccggcgg gtaatagcag cgcggtttcc agcggatttg tattgacgat tgacgccacg      6480
     ccgcccgccg cgccagttat cgccagcgta gcagacaata cggcgccggt aacaggcatc      6540
     gtccctaacg gcggttcgac gaacgaaacc cgtccgacac tcgccggtac cggtgaggcg      6600
     gggtcaacca tctcaattta taatggcagc gcgctggtcg gcaccgcgca agttcaggcc      6660
     aacggtagct ggagctttac gccgcctacc tcgctgagcg cgggcgtctg gaacctgacg      6720
     gcgacagcaa ccgatgcggc aggcaatacc agcgtcgcgt ccgaaacgcg cacgtttact      6780
     attgatacaa cggctcccgc cgcgcctgtt attagcacgg tttacgacgg tacggggccc      6840
     attaccggca atctgagccc aggacagatg acagacgagg ttcgccctgt cattagcggc      6900
     acccgcgaag ccaacacaac cattcgtctc tacgataacg gcacgctgtt ggctgaaatt      6960
     cccgccgaca atagcagtag ttggcgctac acgcccgacg cctctctggc gacgggaaac      7020
     catgtaatta ccgtcattgc cgttgatgcc gcaggcaacg ccagccccgt ttcggacagc      7080
     gttaatttcg tcgtcgatac cacgccgccg ctggcgccgg taatcacgtc agtcagtgac      7140
     gatcaggcgc caggcctcgg cacaatcgcg aacggccaaa gtaccaacga tcctacgcca      7200
     accttcagcg gaactgcgga agccggcgcc acgatcacgc tctatgaaaa tggtacggtc      7260
     attggcacga caacggctca gcctgacggc gcatggagcg tctccacctc aacgctggca      7320
     agcggaacgc acgtcatcac cgccgtcgcc accgatgccg ccgggaacgg cagcccgaac      7380
     agtacggcct tcaccctgac ggtcgatacc accgccccac agacgccaat cctgacgtcc      7440
     gtggtggatg acgtggcggg cggggcaaca ggaaatctcg ctaatggcca gataacgaat      7500
     gataaccgcc ccactctgaa cggcactgcc gaagcaggca gcgtggtcag tatttatgat      7560
     ggcggcactc tgcttggcgt caccacggct gacgcgggcg gcgcgtggag cttcgcgccc      7620
     actaccgggt taagcgacgg cacgcgcacg ttaacagtga ccgccaccga cccagcaggc      7680
     aacgttagcc cagtaaccga cagctttact atcgtcgtcg atacccttgc gccaacggtt      7740
     ccgctcatca ccagcatcgt tgatgatgta ccgaacaaca ccggcgccat tggcaatgga      7800
     caatcgacca acgatacact gcctacgctc aatggtactg cggaagccaa cagtacggta      7860
     agtatcttcg ataatggcgc gctggtcgcg accgtaacgg ctaatgccaa cggcaactgg      7920
     agctggacgc cgaccaccgc gctcggccag gggagtcacg cctatagcgt tagcgccgcc      7980
     gatgcggctg gtaatgttag cgccgcttcg caaccgacaa ctattatcgt ggataccatt      8040
     gcgcccggcg cgcccggcaa cctgaccatc aatgccaccg gtaatcgcgt gacgggcact      8100
     gcggaagcag gcagtacggt gacgattacc actgataccg gtgtggtact gggaaccgcc      8160
     accgccgacg ggacaggcag cttcagcgcc gcactcacgc ccgcgcagac taacggtcag      8220
     ccgctgctgg catttgccca ggataaagca ggcaatactg gcattaccgc cggatttacc      8280
     gcgcccgata cgcgcgtgcc ggaagcgccg attatcacca ccgtggtgga tgacgtgggt      8340
     atttatacgg gcgctatcgc caacggccaa gtcactaatg acgcgcaacc cacattgaac      8400
     ggtaccgctc aggcgggcgc tacagtgagc atttataaca acggggcgtt gctcggcact      8460
     actacggcga acgccagcgg aaactggagc tttactccgg caggcaattt aaccgaaggt      8520
     agccacgcct tcaccgccac cgcgactaac gccaacggaa caggcagcgt ctccaccgcc      8580
     gccacggtga ttgtcgatac gcaggcccct ggaacgccgt caggtacgct tagcgccgat      8640
     ggcggttcgc tttctggact ggcagaggca aacagcaccg tcaccgtcac gctggcgggc      8700
     ggcattacgc tcacgaccac cgctggcagc aacggcgcat ggtctcttac cttgccgaca      8760
     aaacaaattg aaggccaact cattaatgtg acggcaaccg acgccgcggg taacgcctcc      8820
     ggcacgttag gcattaccgc gccgattctg ccgctggcgg caagggataa catcaccagt      8880
     cttgatctaa cctctaccgc cgataccagc acgcaaaact actcggatta cggcttgctg      8940
     ctggttggcg cgcttggcaa tgtcgcctcg gttctgggta acgatatcgc tcaggttgag      9000
     ttcaccattg ccgaaggtgg tacgggagac gtcaccatcg atgccgccgc aacgggaatc      9060
     gtgctttcgc tgctcagtac tcaggagatt gtggtacagc gctatgacac cagcctcggc      9120
     gcctggacga cgatcgtcaa caccgccgtt ggcgacttcg cgaatttgct taccctgacc      9180
     gggagcggcg ttaccctgaa cctgagcgga ctgggcgaag gccagtaccg ggtactcact      9240
     tataacacca gtctgctcgc aaccgggtca tataccagcc tggatgtcga tgtacaccag      9300
     accagcgcag gtattattag cgggccaacc atgagtaccg gcaacgtcat ggctgatgat      9360
     accgcgccga cgggcaccac ggtcaccgcc atcaccaacg ccaacggcgt cagcacgccg      9420
     gtcggcgcgg gcggcgtgga tatccaggga caatacggca cgctgcacat taatcaggat      9480
     ggcagttaca cctacacgtt gactaacccc acggcaggat acgggcataa agagagcttc      9540
     acctacacca tcacccagaa tggcgtcggt agcagttccg cgcaactggt tatcaatctg      9600
     ggtcctgcgc ctgtaccggg cagcgtggtg gcgacagaca ataacgcctc gctggtcttt      9660
     gacacgcacg ttagctacgt caacaacggt ccctcgacac agagcggcgt cacggtatta      9720
     agcgttgggc ttggtaatgt actgaacgcg aatctgcttg atgatatgac caatccgatc      9780
     atctttaacg ttgaagaagg cgctacgcgt accatgacgt tacagggaac cgtcggcggc      9840
     gtctcactgg cttcctcgtt cgatttgtac gtttatcgct tcaacgatgc cattcaacaa      9900
     tatgagcagt tccgggtaca aaaaggctgg attaacaccc tgctgttggc cggacagtcc      9960
     cagccgttga ccctgacgtt gcctggcggc gaatacctgt tcgtgctgaa taccgccagc     10020
     ggcattagcg tcctcacggg ctatacgttg acgatttccc aggaccacac ctatgccgtt     10080
     gacagtatta ccaccagcac aaccggcaac gtattgacca atgatgttgc ccctgcggac     10140
     gccctcctta ctgaagtgaa cggtgtggcg atttctgcga caggcacgac gaatgttaac     10200
     gggctgtatg gcacgctcac tatcgacgca aaaggcaact atacctacac cctgaagaac     10260
     ggcgtcggcg ccgacagtat taaaacgccg gacagcttta tctatacggt caaagcgcca     10320
     aacggcgaca ccgatacggc ctcgctcaat atcacgccaa ccgccagggc gctggatgcg     10380
     attaatgatg tcagcgatac ccttagcgtc gccacgcttc aggataccgc cgcctggctg     10440
     gactccagcg tcggcagcgc cagttgggga ctactcggca aatcgggcag cgggagcggc     10500
     acctttgacg ttgcaacagg caccgtgctt aaaggcgcgt cactggtttt tgatgtctcc     10560
     acgctcatta cgctgggcaa tctgaatatt agctgggcca ttctggagaa cggaaccgtc     10620
     atacgcaacg gaaccgttcc ggtggcgaat atcacgctgg gcggcgcgac agtgactgta     10680
     aacctgagcg gtctggagct ggatgcagga acctacacgc ttaactttac tggtaccaat     10740
     accctggccg gggcggcgac gatcacgcca cgcgttatcg gcaccaccgt cgatctggat     10800
     aattttgaaa cgtccggaac gcatactgtt ctcggcaata tttttgacgg cagcgatgcg     10860
     gcgggggcga tggatcagct taataccgtg aatacccgcc tgaacattag cgggtataac     10920
     ggcagcgctt ccacgctgga cgcctcgaca aatactacca gcgctacgat tcagggacat     10980
     tacggcacat tgcaaattaa cctcgatggc gcctatacct acaccctgaa taatggcatc     11040
     gcgatatcgt ccatcactag taaagaggtc tttacctatc aactggatga caagatgggt     11100
     catacggata gcgctacatt gaccattgat atggtgccgc aaatcgtcag taccaaccaa     11160
     aacgatgttc tcatcggctc cgcctatggc gatacgctga tttaccacct gttaaacggc     11220
     gcggacgcaa ccggcggcaa cggcaccgat cgctggcaaa acttctccac cgcgcaaggc     11280
     gacaagatcg atatccacga actgctgacc ggctgggatc accaggcggc gacgctgggt     11340
     aactttgttc aggttcatac cagcggcgcc aatacggtga tatccgtcga tcgcgacggc     11400
     gccggcagcg cgtttaaatc aactgacctt gtcactctgg agaatgtgca gctcacgcta     11460
     aatgatctgt tgcagaacaa ccatctggta atcggcggtt ga                        11502
//

If you have problems or comments...

PBIL Back to PBIL home page