(data stored in SCRATCH zone)

EMBL: CP000880.PE264

CP000880.PE264       Location/Qualifiers
FT   CDS_pept        complement(272940..273359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2649 1.4e-72 trxC; thioredoxin 2, redox
FT                   factor K03672; COG: COG0526 Thiol-disulfide isomerase and
FT                   thioredoxins; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20218"
FT                   /db_xref="GOA:A9MGV7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV7"
FT                   /inference="protein motif:FPrintScan:IPR006662"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013766"
FT                   /inference="protein motif:HMMTigr:IPR005746"
FT                   /inference="protein motif:ScanRegExp:IPR006662"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461584.1"
FT                   /protein_id="ABX20218.1"
FT                   /translation="MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATSETL
FT                   DKLLKDDLPVVIDFWAPWCGPCRNFAPIFKDVAEERSGKVRFVKVDTEAERELSARFGI
FT                   RSIPTIMIFKHGQVVDMLNGAVPKAPFDNWLNEAL"
     atgaacaccg tttgtaccca ttgccaggcc attaaccgca tccctgacga tcggcttcag        60
     gatgcggcaa aatgtggacg ctgcggtcat gagttatttg acggagaagt cattaatgcg       120
     accagcgaaa cgctggacaa actactgaaa gacgatcttc ctgtagtgat cgatttctgg       180
     gcgccctggt gcggcccttg ccgtaatttt gcgcctatct tcaaggatgt cgctgaagag       240
     cgcagcggta aagtccgttt tgtcaaagtg gataccgagg cggaacggga acttagcgcc       300
     cgtttcggca tccgcagcat cccgacgatt atgatcttta agcatggtca ggtggtcgat       360
     atgcttaatg gcgcagtgcc taaagcgcct tttgacaact ggctgaacga ggcgttgtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page