(data stored in SCRATCH zone)

EMBL: CP000880.PE278

CP000880.PE278       Location/Qualifiers
FT   CDS_pept        284648..284866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20232"
FT                   /db_xref="InterPro:IPR029335"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX1"
FT                   /protein_id="ABX20232.1"
FT                   /translation="MKYIKNIFLVLTFALSAAAFSTSAMAASDTKAPPKANDIPHDPLP
FT                   DMSKFCQDLLEGGGPIPPAMYQYCWQN"
     atgaaataca ttaagaacat atttttagtc ctgacttttg cattgtcggc tgcagctttt        60
     tcgacatctg ccatggccgc cagtgatact aaagctcctc caaaagctaa tgatatacct       120
     cacgatcctc tcccggatat gagtaaattt tgtcaggact tgcttgaagg aggaggcccg       180
     ataccacctg ccatgtatca atactgttgg caaaattaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page