(data stored in SCRATCH zone)

EMBL: CP000880.PE279

CP000880.PE279       Location/Qualifiers
FT   CDS_pept        286325..288358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:427844 4.7e-07 LOC427844; similar to
FT                   leucine-rich repeat kinase 1 K08843; COG: COG4886
FT                   Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20233"
FT                   /db_xref="GOA:A9MGX2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX2"
FT                   /inference="similar to AA sequence:INSD:AAD40326.1"
FT                   /protein_id="ABX20233.1"
FT                   /translation="MSSWEKSKAFFCSTHQTEALECIRTICHPPAGTTREDVVSRFEQL
FT                   RMLAYAGCEENIHSGLHGENHYCIMDEDNQEILSVTLDDAGNYTVNCQEYSETYRLTME
FT                   TEPGEEYTEHAEGASGTSRLPATTAPQTAAEYYAVWSAWQRAAPEGEARGRAAAVKKMR
FT                   DCLKNGNPVLCLERAGLTTLPDHLPPHITILFIPGNNLTSLPALPSGLRELSVSYNQLT
FT                   SLPPLPSGLWKLSVFNNQLASLPPLPSGLQTLWAYHNQLPSLPALPPGLRDLSVSNNQL
FT                   ASLPALPSGLRKLWVSHNQLPSLPELPSGLRALWVSHNQLASLPESITGLSSEATVDLE
FT                   GNPLSERTLQTLRDITSAPDYSGPRIRFDMAGPSVPREARALHLAVADWLMPAREGEPD
FT                   PADRWHASGQEDNAAAFSLFLDRLRETENFEKDAGFKAQISSWLALLAEDDVLRAKTFA
FT                   MATEATSSCQDRITLALHHMKNVQLVHNAEKGVYDNNLPGLVSTGREMFRMEMLERIAR
FT                   EKARTLAFVDEIEVYLAYQNKLKKPLGLTSVTAKMRFFGVSGVTASDLRSAERQVKAAE
FT                   KREFSEWILQWGPLHSVLERKEPERFNALREKQISDYEHTYQMLSDTELKPSGLVGNTD
FT                   AECTIGVRAMESAKKEFLNGLRPLVEEMLGSYLKVKARWRLN"
     atgagctcct gggaaaaaag taaggcattt ttttgctcaa cgcaccagac tgaagcgctg        60
     gagtgcatcc ggacgatttg tcacccgccg gccggaacga cgcgggagga tgtggtcagc       120
     agatttgaac agctcaggat gctcgcgtat gccggatgcg aggaaaacat tcattccggc       180
     ctgcacgggg aaaaccacta ctgtatcatg gatgaagaca accaggagat attatcagtc       240
     accctggacg acgccgggaa ctataccgtg aattgccagg agtacagtga aacatatcgc       300
     ctcaccatgg aaacagaacc gggagaagaa tacacagaac acgcggaagg ggcatccggg       360
     acatcccgcc tccctgccac aacggcgcca cagacggcag cagagtatta tgctgtctgg       420
     tcagcatggc aaagggcggc gccagaagga gaggcacgcg gccgcgcagc agcggtaaag       480
     aaaatgcgtg actgcctgaa gaacggcaat ccagtgcttt gcttggaaag agcaggtctt       540
     accaccttac cagaccattt accaccgcat attacaatac tgtttattcc tggtaataat       600
     ctgaccagcc tgccggcgct gccgtcagga ctacgggagc tgtcggtctc ttataaccag       660
     ctgaccagcc tgccaccgct gccgtcagga ctatggaagt tgtctgtctt taataaccag       720
     ctggccagcc taccaccgct gccgtcagga ctacagacgc tgtgggccta tcataaccaa       780
     ctgcccagcc tgccggcgct gccgccagga ctgcgggatc tgtcggtctc taataaccag       840
     ttggccagcc tgccggcgct gccgtcagga ctacgtaaac tgtgggtctc tcataaccaa       900
     ctgcccagcc tgccggagct gccgtcagga ctacgggcgc tgtgggtctc tcataaccag       960
     ttggccagcc tgccggaaag tatcactggt ctgtcctcag aggcaaccgt agatctggaa      1020
     gggaatccgc tgtctgaacg cactctgcag actctgcggg acataaccag cgctcctgac      1080
     tattcaggcc ccaggatacg attcgatatg gcggggcctt ccgtcccccg ggaagcccgg      1140
     gcactgcacc tggcggtcgc tgactggctg atgccggcac gggaggggga accggaccct      1200
     gcagacagat ggcatgcgtc cggacaggaa gataacgccg ccgccttcag cctcttcctg      1260
     gacagactgc gtgagacgga aaacttcgaa aaggacgcgg gctttaaggc acagatatcg      1320
     tcctggctgg ccctgctggc tgaagatgat gtgctgagag caaaaacttt tgccatggca      1380
     accgaggcaa catcaagctg ccaggaccgg atcacacttg ctctgcacca tatgaagaat      1440
     gtacagctgg tacataatgc agaaaaagga gtatacgata acaatctccc ggggctggtt      1500
     tccacggggc gtgagatgtt ccgtatggaa atgctggaac ggattgcccg ggaaaaggcc      1560
     agaacgctgg ctttcgttga tgaaattgag gtttatctgg cgtatcagaa taagctgaag      1620
     aaaccactcg ggctgaccag cgtgacggca aaaatgcgtt tctttggcgt atccggcgtg      1680
     acggcttcag accttcggag cgctgagcgt caggtgaaag ccgccgaaaa acgcgagttc      1740
     agtgagtgga tactgcagtg gggcccgtta cacagcgtgc tggaacgcaa agagccggaa      1800
     cgctttaacg cgcttcgtga aaagcaaata tcggactatg agcacacgta ccagatgctg      1860
     tctgatacag agctgaaacc gtccgggctg gtcggtaata ccgatgcaga gtgcactatc      1920
     ggagtaaggg cgatggagag tgcgaaaaag gaatttctga atggcctgcg ccctcttgtg      1980
     gaggagatgc tgggtagcta tctgaaagtg aaagcccggt ggcgtcttaa ctga            2034
//

If you have problems or comments...

PBIL Back to PBIL home page