(data stored in SCRATCH zone)

EMBL: CP000880.PE286

CP000880.PE286       Location/Qualifiers
FT   CDS_pept        294435..295166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2573 4.4e-122 pdxJ; carries out
FT                   condensation and ring closure step after PdxA in pyridoxine
FT                   biosynthesis K03474; COG: COG0854 Pyridoxal phosphate
FT                   biosynthesis protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20240"
FT                   /db_xref="GOA:A9MGX9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX9"
FT                   /inference="protein motif:BlastProDom:IPR004569"
FT                   /inference="protein motif:HMMPfam:IPR004569"
FT                   /inference="protein motif:HMMTigr:IPR004569"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217560.1"
FT                   /protein_id="ABX20240.1"
FT                   /translation="MAELLLGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVH
FT                   LREDRRHISDRDVRILRQTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTE
FT                   GGLDVAGQRDKMRDACSRLAAAGIQVSLFIDADEAQINAAAEVGAPFIEIHTGCYANAK
FT                   TDAEQSKELARIASAATLAVRLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRA
FT                   VMSGLKEAVAEMKRLMLEARG"
     atggctgaat tactgttagg cgtcaatatt gaccacatcg ccacgttacg taacgcgcgc        60
     ggcaccgatt atccggaccc ggtacaggcg gcgtttattg ctgaacaggc gggcgcggac       120
     ggcattaccg tacacctgcg cgaagatcgt cgtcacatta gcgatcgcga tgtgcgcatt       180
     ctgcgtcaga cgctgcatac gcgcatgaat ctggagatgg cggtgaccga agagatgctg       240
     gcgatcgccg tggaaaccag accgcatttc tgttgtctgg tgccggaaaa acgccaggaa       300
     gtcaccaccg aaggcggtct ggacgtggcc ggacagcgcg ataaaatgcg cgatgcctgt       360
     tcgcgtctgg cggccgctgg catccaggtt tcactcttta tcgatgccga tgaggcgcaa       420
     atcaacgcgg cggcggaagt gggcgcgccg tttatcgaaa ttcataccgg ctgctatgcc       480
     aacgcgaaaa ccgatgcgga acagtcaaag gagctggcgc gtattgccag cgccgcgacc       540
     ctggccgttc gtctgggtct aaaagtgaat gctggtcatg gtctgactta ccataacgtc       600
     aaagccattg ccgcgctgcc ggaaatgcac gagctcaata tcggtcatgc cattattggt       660
     cgggcggtga tgagtggcct taaagaggcg gtggctgaaa tgaaacgtct gatgctggaa       720
     gcgcgcggtt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page