(data stored in SCRATCH zone)

EMBL: CP000880.PE29

CP000880.PE29        Location/Qualifiers
FT   CDS_pept        32933..33694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3052 2.5e-135 surE; acid phosphatase
FT                   K03787; COG: COG0496 Predicted acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19983"
FT                   /db_xref="GOA:A9MF31"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF31"
FT                   /inference="protein motif:BlastProDom:IPR002828"
FT                   /inference="protein motif:HMMPfam:IPR002828"
FT                   /inference="protein motif:HMMTigr:IPR002828"
FT                   /inference="similar to AA sequence:SwissProt:P66881"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX19983.1"
FT                   /translation="MRILLSNDDGIHAPGIQTLAKALREFADVQVVAPDRNRSGASNSL
FT                   TLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYS
FT                   GTVAAAMEGRHLGFPALAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDL
FT                   PLAQIKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYV
FT                   SVTPLHVDLTAHSAHDVVSDWLDSVGVGTQW"
     atgcgcatat tgctgagtaa cgatgacggg attcacgcgc ccggtataca aacgctggcg        60
     aaagcgctgc gtgagtttgc tgatgtacag gtcgtagccc cggatcgtaa ccgcagcggc       120
     gcgtctaatt ctctgacgct ggaatcttcg cttcgtactt ttacctttga taatggcgac       180
     atagccgtac agatgggaac gccgaccgat tgcgtctatc tgggcgttaa tgccttaatg       240
     cgtccgcgtc cggatattgt cgtctccggt attaacgcgg gtccgaatct gggcgatgat       300
     gtgatctatt ccggtactgt cgctgcggcg atggaaggtc gtcatctcgg cttcccggcg       360
     ttggctgtct ctcttaacgg ctatcagcat tatgatacgg cagcggccgt gacttgcgcg       420
     cttctgcgag ggttaagccg ggagccgttg cgtaccggac gtattctcaa cgtgaatgtc       480
     ccggatctgc cgctggcgca gattaaaggc atccgcgtga cccgctgcgg tagtcgccat       540
     ccggcggata aagtgatccc gcaggaagat ccgcgcggta atacactgta ctggattggc       600
     ccgccgggcg ataaatacga cgccggaccg gatactgatt tcgcggcagt ggatgaaggc       660
     tacgtctccg tcacgccgtt gcatgtggat ttaaccgcgc acagcgcgca tgatgtggtt       720
     tcagactggt tagacagcgt gggagttggc acgcaatggt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page