(data stored in SCRATCH zone)

EMBL: CP000880.PE319

CP000880.PE319       Location/Qualifiers
FT   CDS_pept        330899..331285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_1354 9.8e-16 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   K00566; COG: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20273"
FT                   /db_xref="GOA:A9MHJ5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHJ5"
FT                   /inference="protein motif:HMMPfam:IPR002871"
FT                   /inference="protein motif:HMMTigr:IPR011339"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149655.1"
FT                   /protein_id="ABX20273.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSFDNNDDNVGSGMVGAPACGDVMKLQI
FT                   KVNDEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKI
FT                   HCSILAEDAIKAAIADYKSKREAK"
     atggcttaca gcgaaaaagt aatcgatcac tatgagaacc cgcgtaacgt agggtcgttt        60
     gacaataacg acgataacgt gggaagcggc atggttggcg ctccggcctg cggcgacgtc       120
     atgaagttgc agattaaagt taacgatgaa ggtatcattg aagacgcgcg cttcaagact       180
     tacggctgcg gttccgctat cgcctccagc tctctggtaa cggagtgggt gaaagggaaa       240
     tcgctggacg aagctcaggc gattaaaaac accgatatcg cagacgaact tgagctgccg       300
     ccggtgaaaa ttcactgctc tattctggcg gaagacgcga ttaaagccgc tattgcggat       360
     tacaaaagca aacgcgaagc gaaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page