(data stored in SCRATCH zone)

EMBL: CP000880.PE321

CP000880.PE321       Location/Qualifiers
FT   CDS_pept        331904..332419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00336"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1076 DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20275"
FT                   /db_xref="GOA:A9MHJ7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHJ7"
FT                   /inference="protein motif:HMMPfam:IPR001623"
FT                   /inference="protein motif:HMMPfam:IPR012895"
FT                   /inference="protein motif:HMMSmart:IPR001623"
FT                   /inference="protein motif:HMMTigr:IPR004640"
FT                   /inference="protein motif:superfamily:IPR001623"
FT                   /inference="protein motif:superfamily:IPR009073"
FT                   /inference="similar to AA sequence:INSD:AAL21434.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20275.1"
FT                   /translation="MDYFTLFGLPASYHIDTQALSLRFQDLQRQYHPDKFANGTQAQHL
FT                   AAVQQSATINQAWQTLRHPLTRAEYLLSLHGFDLASEQHTVRDTAFLMEQLTLREELDD
FT                   IEQTKDDARLESFIKRVQKMFDTRLQQMVTQLDNAAWGEAADTVRKLRFLDKLRSSADQ
FT                   LEEKLLDF"
     atggattact tcaccctctt tggcttaccg gccagttatc atattgacac ccaggcgctg        60
     agccttcgtt ttcaggatct gcagcgccag tatcaccctg acaaatttgc caacggcacc       120
     caggcgcagc atcttgccgc cgtccagcaa tccgccacta tcaaccaggc ttggcaaacg       180
     ctgcgtcacc cgctgacgcg cgcagaatat ctgctttcct tacacggatt cgatctggcc       240
     agcgagcagc atacggtacg tgacaccgcg tttctgatgg agcaactgac gcttcgcgaa       300
     gagctggacg acatcgaaca gacaaaagac gacgcgcggc tggaaagttt tatcaaacgc       360
     gtacaaaaga tgtttgatac tcgccttcag caaatggtga cgcagcttga caacgcggcg       420
     tggggcgagg cggcggatac ggtgcgcaaa ctgcggtttc tcgataaact gcgaagcagc       480
     gcagatcaac tcgaagaaaa gctgctcgat ttttaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page