(data stored in SCRATCH zone)

EMBL: CP000880.PE34

CP000880.PE34        Location/Qualifiers
FT   CDS_pept        complement(36715..36951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00034"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14130 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19988"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF36"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457312.1"
FT                   /protein_id="ABX19988.1"
FT                   /translation="MICPRCADEHIELMATSPVKGVWTVYQCQHCLYTWRDTEPLRRTS
FT                   REHYPQAFRMTQKDIDNAPMVPSIPPLLAEDKR"
     atgatttgtc cacgctgtgc cgatgaacat attgaactca tggcgacttc gccggtaaaa        60
     ggagtctgga cggtatatca gtgtcagcat tgcctgtata cctggcgcga taccgaacca       120
     ttacgccgta ccagccgcga acactatcca caagcgtttc gcatgacgca aaaagatatt       180
     gataacgcgc caatggtgcc gagtattccg ccgctactgg cagaagataa acggtaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page