(data stored in SCRATCH zone)

EMBL: CP000880.PE344

CP000880.PE344       Location/Qualifiers
FT   CDS_pept        360097..360345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_1764 6.9e-14 ubiquitin ligase sinat5
FT                   K01932; COG: NOG17950 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20298"
FT                   /db_xref="InterPro:IPR010807"
FT                   /db_xref="InterPro:IPR029037"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM0"
FT                   /inference="protein motif:HMMPfam:IPR010807"
FT                   /inference="similar to AA sequence:INSD:AAP83330.1"
FT                   /protein_id="ABX20298.1"
FT                   /translation="MDYALEENVVEITCPVCHRALERNGNAAHCATCVKDFVLQAICPD
FT                   CRQPLQVLKACGAVDYFCQNGHGLVSKKRVNFVISEQ"
     gtggattatg ctcttgagga gaatgttgtg gaaataacct gccccgtgtg ccatcgagcg        60
     ctggagcgaa atggtaatgc tgcgcattgc gcgacatgcg ttaaagattt cgtgttgcaa       120
     gcgatttgcc ccgactgtcg ccagccgtta caggttttga aagcctgtgg cgcggtggac       180
     tatttttgcc agaacggtca tggtttagtt tcaaaaaaac gggttaattt cgttatttcc       240
     gaacaataa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page