(data stored in SCRATCH zone)

EMBL: CP000880.PE347

CP000880.PE347       Location/Qualifiers
FT   CDS_pept        complement(362076..363440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0355 3.2e-213 xseA;
FT                   exodeoxyribonuclease large subunit K03601; COG: COG1570
FT                   Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20301"
FT                   /db_xref="GOA:A9MHM3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHM3"
FT                   /inference="protein motif:HMMPfam:IPR003753"
FT                   /inference="protein motif:HMMPfam:IPR004365"
FT                   /inference="protein motif:HMMTigr:IPR003753"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:SwissProt:Q5PI54"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20301.1"
FT                   /translation="MLSSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFTQPASG
FT                   HWYFTLKDDTAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQP
FT                   AGEGLLQQKYEQLKAKLQAEGLFDQQYKHPLPSPAYCVGVITSKTGAALHDILHVLKRR
FT                   DPSLPVIIYPAAVQGEDAPGQIVRAITLANARKECDVLIVGRGGGSLEDLWSFNDERVA
FT                   RAIFASTIPVVSAVGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQMQTACQRL
FT                   EMAMDYYLANRQRRFSQLYHRLQQQHPQLRLARQQTTLERLRQRMHLALENQLKQANQR
FT                   QQRASQRLRQQNPQPRIHRAQSRIQQLEYRLAENFRARLSEQRERFGNTVTHLEAVSPL
FT                   ATLARGYSVSTATDGNVLKKVKQLKVGDMMTTRLKDGWVTSEVTAIKPVKKIRLG"
     atgttatcct ctcagacttc ctcaattttt accgtaagcc gccttaacca gacggttcgt        60
     ctgttgttag aacaggagat gggtcaggtg tggatcagcg gcgagatctc taatttcacg       120
     cagcctgctt cgggtcactg gtactttacg ctcaaagacg ataccgccca agtgcgctgt       180
     gcgatgttcc gtaacagcaa ccgccgagtc acgttccgcc cgcagcacgg gcagcaagtg       240
     ctggttcgcg ccaacatcac gctatatgag ccacgcggtg actaccagat tatcgtcgaa       300
     agcatgcagc ctgctggcga agggcttttg cagcagaagt atgagcagct caaagcaaag       360
     ctccaggccg aaggcctttt cgatcaacag tataaacatc cgctaccctc cccggcctac       420
     tgcgttgggg ttatcacgtc aaaaaccggc gctgctctgc acgatattct ccacgtacta       480
     aaacgtcgtg acccttcgct gcccgttatc atctacccgg ccgccgtaca gggtgaagat       540
     gcgccaggcc agattgtgcg cgcaattaca cttgcaaacg cacgcaagga gtgtgatgta       600
     ttaatcgttg ggcgcggtgg cggctcgctg gaagatttgt ggagctttaa cgacgagcgc       660
     gtggcgcggg caatttttgc aagtaccatt ccggtggtaa gcgccgtcgg ccacgaaaca       720
     gacgtcacga tagccgattt tgtcgctgac ttgcgcgcgc ctacgccgtc cgctgcggcg       780
     gaggtcgtca gccgcaacca gcaagagcta ctgcgccaaa tgcagaccgc atgccagcga       840
     ctggaaatgg cgatggatta ttatctggct aaccgccaac ggcggtttag ccaactgtac       900
     caccgtctgc aacagcagca tccgcaactg cgactggcgc gtcaacagac caccctggaa       960
     cggctgcgcc agcgtatgca tcttgcgctg gaaaaccagt taaaacaggc gaaccagcgc      1020
     caacagcgcg cgtcacagcg tctgaggcag caaaacccgc aaccgcgcat ccaccgtgcg      1080
     cagtcgcgca ttcagcaact ggaatatcgc ctggcggaaa acttccgcgc acggttaagc      1140
     gaacagcgcg agcgtttcgg taatacggta acgcacctgg aagccgttag cccgctggcg      1200
     acgctggcgc gaggctacag tgtctcaacc gcaaccgacg gtaacgtcct gaaaaaagta      1260
     aagcagctta aagtgggcga tatgatgacc actcggttga aggacggttg ggtgaccagt      1320
     gaagtgaccg ccatcaaacc tgtaaagaag atccgtttag gataa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page