(data stored in SCRATCH zone)

EMBL: CP000880.PE349

CP000880.PE349       Location/Qualifiers
FT   CDS_pept        365137..366714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2751 5.3e-284 guaA; GMP synthase
FT                   (glutamine-hydrolyzing) K01951; COG: COG0518 GMP synthase -
FT                   Glutamine amidotransferase domain; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20303"
FT                   /db_xref="GOA:A9MHM5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHM5"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="protein motif:HMMPfam:IPR001674"
FT                   /inference="protein motif:HMMPfam:IPR004506"
FT                   /inference="protein motif:HMMTigr:IPR001674"
FT                   /inference="protein motif:HMMTigr:IPR004739"
FT                   /inference="protein motif:ScanRegExp:IPR012998"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804218.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20303.1"
FT                   /translation="MTDNIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQ
FT                   IREFNPSGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSN
FT                   EREFGYAQVEVLTDSALIRGIEDSLTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESC
FT                   PFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVARIR
FT                   EQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHF
FT                   GLNIVHVPAEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPD
FT                   VIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLY
FT                   RHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVG
FT                   VMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYGFLGRVSNRIINEVNGISRVVYDISGK
FT                   PPATIEWE"
     atgacagaca atattcataa acatcgcatt ctcatcctgg atttcggttc ccagtacact        60
     cagttggtgg cgcgtcgcgt gcgtgaactg ggcgtttact gcgaactgtg ggcgtgggat       120
     gtcacggaag cgcagattcg cgaatttaat cccagcggga ttatcctttc cggcggcccg       180
     gaaagcacca ctgaagaaaa tagcccgcgc gcgccgcagt atgtgtttga ggcgggcgtg       240
     ccggtgtttg gcgtctgcta cggtatgcag actatggcga tgcagcttgg cggtcatgtg       300
     gaaggttcta atgagcgtga atttggctat gcgcaggtcg aagtgctgac cgatagcgca       360
     ctgattcgcg gtattgaaga ctctctgacc gctgacggca aaccattgct ggatgtttgg       420
     atgagccatg gtgataaagt gacggcgatt ccgtccgact ttgtgacggt tgccagcact       480
     gaaagctgcc cgttcgcaat catggcgaac gaagaaaaac gcttctacgg cgtgcagttc       540
     cacccggaag tgacccatac tcgtcaaggg atgcgtatgc tggagcgttt tgtacgcgat       600
     atttgccagt gtgaagcgtt gtggactccg gcgaagatca tcgacgatgc cgtagcccgc       660
     attcgcgagc aggtaggcga cgataaagtt attctcggcc tctccggcgg cgtggactcc       720
     tccgtcaccg caatgctgct gcaccgcgcc atcggtaaaa atctgacctg tgttttcgtc       780
     gataacggcc tgctgcgcct caacgaagcc gagcaggtga tggacatgtt tggcgaccat       840
     tttggtctga acattgttca cgtaccggca gaagatcgct tcctgtccgc gttggctggc       900
     gagaacgatc cggaagccaa gcgtaagatc attggccgtg ttttcgtgga agtgttcgat       960
     gaagaagcgc ttaagctgga agatgtgaaa tggctggcgc aggggactat ctatcctgat      1020
     gtgatcgaat ctgccgcctc cgcaaccggt aaagcgcatg tcatcaaatc tcaccacaat      1080
     gtcggcggcc tgccgaaaga gatgaagatg gggctggttg aaccgctgaa agagctgttc      1140
     aaagatgaag tacgtaagat tggtctggag ctgggcctgc cgtatgacat gctgtatcgc      1200
     catccgttcc cggggccggg cctcggcgtg cgcgtactgg gcgaagtgaa gaaagagtac      1260
     tgtgacctgc tgcgtcgcgc agacgctatc ttcattgaag agctgcgcaa agcggatctg      1320
     tacgacaaag tgagtcaggc gtttactgtc ttcctgccgg tccgttccgt aggcgtcatg      1380
     ggtgatgggc gtaagtacga ttgggtggtc tccctgcgtg ccgtcgaaac tatcgacttt      1440
     atgaccgcgc actgggcgca tctgccgtat ggcttcctgg gacgcgtttc caaccgcatc      1500
     atcaatgaag tcaacgggat ttcccgtgtg gtgtatgaca tcagcggtaa accaccggca      1560
     acaattgagt gggaataa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page