(data stored in SCRATCH zone)

EMBL: CP000880.PE352

CP000880.PE352       Location/Qualifiers
FT   CDS_pept        complement(368896..369456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00369"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23066 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20306"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM8"
FT                   /inference="similar to AA sequence:INSD:ABG70793.1"
FT                   /protein_id="ABX20306.1"
FT                   /translation="MKINLFNLFRKKNKLQDDFPVTQFSALPKKGEGYPSFFSLEKNNI
FT                   YAHSACFMIKPDDISFIEHLVELFFHAKVKVSEIKEKFADHDKVLICYKFKEFEQEVVR
FT                   LITNDNEFINCLCEKGLEPPDPECVFPDKDFGTYGSLQGDMEFWWHVYWKPFWESLKEE
FT                   ERKQYLERSNLSIGTIEFLEHHH"
     atgaaaatta atttatttaa cttgttcagg aaaaaaaata aattacagga tgattttcct        60
     gttactcaat tcagtgcttt gccaaaaaag ggggagggat atccatcatt tttttctcta       120
     gagaaaaaca atatatatgc acactcagca tgctttatga taaaacctga tgatatatca       180
     ttcattgaac atttggttga attatttttt catgcaaagg taaaagtaag tgagataaaa       240
     gaaaagtttg cagaccatga taaagttctg atttgctata aatttaagga gtttgaacag       300
     gaagttgtaa ggcttatcac aaatgataat gaatttatca attgcctttg tgaaaaaggt       360
     ttagaacctc cagacccaga gtgtgtattt cctgataagg actttggtac ttatggtagt       420
     ctgcaaggag atatggagtt ttggtggcat gtatactgga aaccattttg ggaaagtttg       480
     aaagaggaag aaagaaaaca atatctcgaa cgaagcaatt tatcgattgg taccattgaa       540
     tttcttgaac accaccatta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page