(data stored in SCRATCH zone)

EMBL: CP000880.PE360

CP000880.PE360       Location/Qualifiers
FT   CDS_pept        375964..378177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3829 5.3e-23 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s) K01745;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20314"
FT                   /db_xref="GOA:A9MHN6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN6"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABX20314.1"
FT                   /translation="MKLNKTYINIRDKWWGLPLLLPSILLPVLSSANTYAHTSTGNVVL
FT                   FYLPLAFMFSLMLFFGWAALPGIVIAIFWRTYPQMGLYETLSVTMHFIITIVLSWGGYR
FT                   VFAPRRNNVSHGDARLIFQRMFWQVFCSATLFLVIYQCAAFVGMYESKSSLMGIMPFNI
FT                   NTLINYQALLVGNLIGVPLCYFIIRTIRNPLHLRGYYQQLKLQVDSKTTKKEIVIWLAV
FT                   LITLMFILCMPLTDNSSIFSTNYTLSLLLPVMLWGAMHYGYKFISIIWAFVLITSIHYY
FT                   QRYMPWYSGYDTQLAITSSSYLVFSFIVNYMAVLATRQRVVSSRARRLAYLDPVVHLPN
FT                   LRALNRALKNAPCSTLCFLHVPGLELLGKNYGVMLRIQYKQKLSHWITQMLASNECVYQ
FT                   MSGHDLVLRLNTESYQQRIEALDKHIKQFRFIWDGLPLQPPVGVSYCCVRSPVSHLYLL
FT                   LGELGTSSDLSLTTNAPEDLQRRGAVHLQRDLKGRVAMMNRLQQALEHDHFFLMAQPIS
FT                   GVRGDVYHEILLRLRDENGDVINPDNFLPVAHEFGLSSAIDLWVIENTLRFIATSREYM
FT                   PAHRFAVNLSPTSVCRAPFPSEVNQLLTQYQVEPWQLVFEVTESNSLTNADQAQLTLGQ
FT                   LQQFGCQIAIDDFGTGYASYARLKNVNADILKIDGSFIRNIVSNSLDYQIVSSICHLAR
FT                   MKKMQVVAEYVESEEIRSAVLSLGIDYLQGYLIGEPQPLSEIQ"
     atgaagctaa ataaaactta tataaatatc agagataaat ggtggggact gccgctcctc        60
     ctgccttcaa ttttattacc tgttttaagt agcgcaaata cttatgcgca taccagtact       120
     ggaaatgtgg ttctgtttta cctgccgtta gcttttatgt ttagcctaat gttgtttttc       180
     ggctgggcag cactgccggg cattgtgatt gctatctttt ggcgtacata cccacagatg       240
     gggctatatg aaaccctttc cgtgacgatg cactttatca ttaccatcgt gctaagctgg       300
     ggcggctacc gcgtctttgc cccccggcga aacaatgttt cccacggcga tgctcgcttg       360
     atcttccaac gaatgttctg gcaggtattt tgttcggcga cattatttct ggtgatttac       420
     cagtgtgccg cctttgttgg catgtacgaa agcaaatcca gcctgatggg gataatgccc       480
     tttaatatta acacgctgat taactaccag gctttactgg tcggcaatct tatcggtgtg       540
     ccattgtgct attttattat tcgtactatc cgcaatccgc tgcacctgcg cgggtattat       600
     cagcaattaa agctacaagt tgatagcaag accactaaaa aagagattgt tatttggtta       660
     gccgtattga ttacactgat gtttatactg tgtatgccat tgactgataa tagctcaata       720
     tttagtacca actatacgct ttcgttacta ttgccggtaa tgctatgggg cgcgatgcac       780
     tatggctata aatttatttc aataatctgg gccttcgtgc tgattacgtc gattcattat       840
     taccagcgtt atatgccctg gtattcaggt tatgatacac aattagccat tacctcttcg       900
     agctatctgg ttttttcttt tattgttaat tatatggctg tactggccac acgccagcgc       960
     gtcgtaagca gtcgcgcgcg gcggctggcc tatcttgacc cggttgtaca tcttcccaat      1020
     ttacgtgcgc taaaccgcgc gctcaaaaac gcgccctgct ctacgctctg ttttttacat      1080
     gtgccgggcc tggagctatt gggtaaaaat tatggcgtta tgctgcgcat ccagtataag      1140
     caaaagcttt ctcactggat tacgcagatg ctggcctcaa atgaatgtgt gtaccagatg      1200
     tcagggcacg acctggtgct gcgtcttaat acagagtcgt atcagcaacg aattgaagcg      1260
     ctggataaac atattaagca gtttcggttt atctgggacg ggctaccgct acaacccccc      1320
     gtcggcgtga gctactgttg cgtgcgttcc ccggtcagcc acctttatct tctgctgggc      1380
     gagttaggca ccagttccga tctttcgttg acgacgaatg cgccggaaga tttacagcgg      1440
     agaggcgcgg tgcatctgca gcgcgatttg aagggaagag ttgcgatgat gaaccgcctg      1500
     caacaggcgc tggagcacga tcattttttc ctgatggcgc aacccatttc cggtgtgcgt      1560
     ggggacgttt accatgaaat tttactgcgg ctcagggatg aaaacggcga cgttattaac      1620
     ccggacaatt ttttacctgt ggcgcatgag tttggtttgt cttccgctat cgatctctgg      1680
     gtgattgaaa acactctgcg gtttatagcg accagccggg aatatatgcc cgcacatcgc      1740
     tttgccgtta atctgtcgcc aacatcggta tgtcgtgccc cttttccttc agaagttaat      1800
     caattgctta ctcaatatca ggttgagccc tggcaactgg tttttgaggt gacggaaagc      1860
     aattccctca ccaatgccga tcaggcgcag ttgacgctgg ggcagttaca gcagtttggc      1920
     tgtcagatag cgattgatga ttttggtact ggctacgcca gctatgcgcg gctgaaaaac      1980
     gttaacgccg atattcttaa aattgatggt agttttatcc gcaatatagt gtcaaacagt      2040
     ctcgattatc agattgtgtc ttctatttgt catttagcgc gaatgaaaaa aatgcaggtt      2100
     gtcgcggagt acgtcgaaag cgaagaaata cgcagcgcgg tgctctcatt ggggatcgac      2160
     tatcttcagg gatatttaat tggcgaaccg cagccattat ctgagattca gtaa            2214
//

If you have problems or comments...

PBIL Back to PBIL home page