(data stored in SCRATCH zone)

EMBL: CP000880.PE361

CP000880.PE361       Location/Qualifiers
FT   CDS_pept        complement(378213..379754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2743 1.0e-273 ppx; exopolyphosphatase
FT                   K01514; COG: COG0248 Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20315"
FT                   /db_xref="GOA:A9MHN7"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN7"
FT                   /inference="protein motif:HMMPfam:IPR003695"
FT                   /inference="similar to AA sequence:SwissProt:P0A269"
FT                   /protein_id="ABX20315.1"
FT                   /translation="MPIYDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRV
FT                   HLADGLGADNKLSEEAMERGLSCLSLFAERLQGFSPSSVCIVGTHTLRQAQNAADFLKR
FT                   AEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPRLVE
FT                   SRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQYRIQGWNVAMGASGTIKA
FT                   AHEVLLALGEKDGFITPERLDELKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGV
FT                   FDALAIRELRLSDGALREGVLYEMEGRFRHQDVRSRTAKSLANQYNIDREQARRVLETT
FT                   MQMYEQWQAQQPKLAHPQLEALLRWAAMLHEVGLNINHSGLHRHSAYILQHSDLPGFNQ
FT                   EQQMMMATLVRYHRKAVKLDDMPRFTLFKKKQYLPLIQLLRLGVLLNNQRQATTTPPTL
FT                   RLTTNDNHWTLCFPHDWFSQNALVLLDLEKEQQYWEAVTGWRLNIEEENSPEIAA"
     atgccaattt acgataaatc ccctcgacca caggaattcg ctgcggtcga tctcggctca        60
     aacagctttc atatggtcat tgcccgcgtg gttgacggcg caatgcagat tatcgggcgc       120
     ttaaagcagc gcgtccatct ggcagacgga ctgggcgcag ataacaaact cagcgaagaa       180
     gccatggagc ggggacttag ctgtttgtcg ttgtttgctg aacgcttaca aggcttctcc       240
     ccttccagcg tctgtatcgt gggtacccac acgttacgtc aggcgcaaaa tgccgctgat       300
     tttctcaaac gcgcggaaaa ggttattccc tacccgatag agattatttc cggtaacgaa       360
     gaagcgcgcc ttatttttat gggtgtagaa catacgcaac cggaaaaagg ccgcaagctg       420
     gtgatagata ttggcggtgg atcaactgag ctggttattg gcgaaaattt cgaacccagg       480
     ctggttgaaa gccgtcgtat gggctgcgtg agctttgcac agctctactt tcccggcggc       540
     gttatcaata aagagaactt ccagcgcgcc cggatggcgg cagcgcaaaa actggaaacc       600
     ttaacctggc agtatcgtat tcagggatgg aatgtggcga tgggcgcttc cggtacgatt       660
     aaggccgccc atgaagttct cctggcgttg ggcgagaaag atggctttat tacgccggag       720
     cgcctcgacg aacttaagtc agaagtgctg aagcaccgct cctttaatgc gctcagcctg       780
     ccgggccttt ctgaagagcg aaaagcggtc tttgtgccgg gactggcgat tctgtgcggc       840
     gtttttgatg cgctggctat ccgcgagctt cgtctttccg atggcgcgtt gcgagaaggc       900
     gtactgtatg aaatggaggg ccgtttccgc caccaggatg tccgcagccg tacagcgaaa       960
     agtctggcga atcaatacaa cattgacaga gaacaggcca gacgcgtgct ggaaaccacc      1020
     atgcagatgt acgaacagtg gcaggcccag cagccgaaac tggcgcatcc gcagctcgaa      1080
     gcgttactcc gttgggcagc catgctgcat gaggttggac tgaatattaa tcacagtggt      1140
     ttacatcgcc attcggctta tattctgcaa catagcgatt tgcccggttt taatcaggag      1200
     cagcaaatga tgatggcgac gctggtacgt tatcatcgca aagccgtaaa gctggatgat      1260
     atgcctcgct ttacgctgtt taagaaaaaa cagtatctgc cgttaattca gctactacgg      1320
     ctgggcgtat tactaaacaa ccagcggcaa gcgacaacca cgccgccaac gctgcggcta      1380
     acgaccaatg acaaccactg gacgttatgt tttccgcatg actggttcag ccagaatgcg      1440
     ctggtactgc ttgatctgga aaaagaacag cagtactggg aagcggtgac tggctggcgt      1500
     cttaatattg aggaagaaaa ctcgccggag atcgccgcgt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page