(data stored in SCRATCH zone)

EMBL: CP000880.PE37

CP000880.PE37        Location/Qualifiers
FT   CDS_pept        39119..39556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00037"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1846 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19991"
FT                   /db_xref="GOA:A9MF39"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF39"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000835"
FT                   /inference="protein motif:HMMSmart:IPR000835"
FT                   /inference="protein motif:ScanRegExp:IPR000835"
FT                   /inference="similar to AA sequence:INSD:AAX66756.1"
FT                   /protein_id="ABX19991.1"
FT                   /translation="MIEKVNLSGVIMELRNTAFHLLRQLFQQHTARWQHELPELTKPQY
FT                   AVMRAIAEHSGIEQVDLTEAAVCTKATLAEMLSRMENRGLVKRENDPLDKRRRFVYLTA
FT                   QGRALLAAAIPLGDRVDDEFLGRLSDEEREQFAQLVRKMMA"
     atgatagaaa aggttaattt atccggagtg atcatggagt tacgaaacac cgcgtttcat        60
     cttttacgtc aactttttca gcaacatacc gcgcgctggc agcatgaact accggaactc       120
     accaagcctc aatatgcggt aatgcgcgcc attgctgagc attctggtat tgaacaggtc       180
     gatctgaccg aagcggcggt ctgcactaaa gcgacgctgg cggagatgtt aagccggatg       240
     gaaaatcgtg ggctggtaaa gcgagaaaac gatccgctgg ataagcgtcg gcgctttgtg       300
     tatctcactg cccaaggccg ggcactgctc gccgccgcga tacctctggg tgaccgcgtg       360
     gacgatgagt ttttggggcg actgagcgat gaagaacgcg aacagtttgc gcaactggta       420
     cgcaagatga tggcgtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page