(data stored in SCRATCH zone)

EMBL: CP000880.PE385

CP000880.PE385       Location/Qualifiers
FT   CDS_pept        complement(406716..408413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2480 2.8e-285 narQ; sensory histidine
FT                   kinase in two-component regulatory system with NarP (NarL)
FT                   K07674; COG: COG3850 Signal transduction histidine kinase,
FT                   nitrate/nitrite-specific; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20339"
FT                   /db_xref="GOA:A9MHR1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR1"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR011712"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:INSD:AAL21374.1"
FT                   /protein_id="ABX20339.1"
FT                   /translation="MTVKRPVSASLAKAFFYIVLLSILSTGSALLTLTSSLRDAEAINI
FT                   AGSLRMQSYRLGYDLQSRSPQINAHRQLFQHALNSPVLRNLNAWYVPQAVKNRYARLHA
FT                   NWLEMNSRLQGGDIAWYQTNINNYVDQIDLFVLALQHYAERKVMLVVAISLAGGIGIFT
FT                   LVFFTLRRIRQQVVRPLNQLVTASQRIEHGQFAPLPLDTSLSNELGLLAKTFSQMSSEL
FT                   HKLYRSLEASVEEKTRDLHEAHRRLEVLYQCSQALNTSQIDVHCFRHILRIVREHDAAW
FT                   YLKLTVGDNWRISEGTQRPNLPVQILPVTMQDTVYGELHWQSPNVDASTPLLNSVSTML
FT                   GRGLYFNQAQKHFQQLLLMEERATIARELHDSLAQVLSYLRIQLTLLKRAIPEDNACAQ
FT                   SIMTDFSRALNDAYRQLRELLTTFRLTLQQADLPSALHEMLEDLQSQTPAKLTLDCRLP
FT                   TLALDAQMQVHLLQIVREAVLNAIKHANATEIAVSCVTAPDGDHTVYIHDNGIGIGEPH
FT                   EPVGHYGLNIMRERAERLGGTLNFSQPSGGGTLVSISFRSSSGEDIAS"
     gtgacggtta aacgcccggt ctcggccagt ctggctaagg cttttttcta tattgtgctg        60
     ttgtctattc tgtccaccgg cagcgcatta ctgacgctga ccagcagttt acgggatgcc       120
     gaagcgatca atatcgccgg ttcgctacga atgcagagct atcggttggg ctacgatctg       180
     caaagccgta gtccgcagat taatgcgcat cgccaacttt ttcagcacgc gctcaactcg       240
     ccggtactgc gaaatctcaa cgcctggtat gtgccgcagg cggtgaaaaa tcgctacgcg       300
     cgcctgcacg caaactggct ggagatgaac agccgcctac agggcggcga catcgcatgg       360
     tatcagacga atatcaacaa ttacgtcgat caaattgatc tcttcgttct ggcgttacag       420
     cattacgccg aacgcaaagt catgctagtt gtcgccatat ctctggcggg cggtatcggc       480
     atatttacac tggtcttttt taccctacga cgtattcgcc agcaggtggt tcgcccgctt       540
     aatcaactgg tcaccgccag ccagcgtatt gaacacggac agttcgcccc gctgccactc       600
     gataccagct tatccaatga actgggatta ttggcgaaaa cgtttagtca gatgtcgagc       660
     gagctgcaca aactttaccg ttcgttggaa gcctcggtgg aagaaaaaac gcgtgatctg       720
     catgaagcgc accgccgcct ggaggtgcta taccagtgct cccaggcgct gaataccagc       780
     cagatcgatg tccactgttt tcgccatatt ttacgaattg tccgtgaaca tgacgccgcc       840
     tggtatctga agttaaccgt gggcgataac tggcggatta gcgaaggcac gcaacgtccc       900
     aatctaccag tgcaaatact gccggtcaca atgcaggaca cggtctatgg cgaactccac       960
     tggcaaagtc ctaacgttga tgcctccacg ccgttgttga acagcgtctc cacgatgctg      1020
     ggtcgcggtc tgtactttaa tcaggcgcaa aaacacttcc agcaactttt gttaatggaa      1080
     gaacgcgcaa cgattgcccg tgagctgcac gactcgctgg cgcaggtact ttcttattta      1140
     cgtattcagt taacgctttt gaaacgcgcc attccagaag ataacgcctg tgcgcaaagc      1200
     attatgacgg atttttcaag ggcgctgaat gacgcctacc gtcagcttcg cgaactactc      1260
     accacgttcc gtctgacatt acagcaggcc gatttaccct ccgcattgca cgagatgctg      1320
     gaagacttac agagtcagac gccggccaaa cttacgctgg attgccgttt gcctacgctg      1380
     gcgctggatg cgcaaatgca ggtgcatttg ttgcaaattg tacgtgaagc ggtcctgaac      1440
     gcgattaagc acgccaacgc gaccgaaatc gcagtgagtt gcgtcaccgc gcctgacggc      1500
     gatcataccg tttatattca tgataatggc attggtatcg gcgaaccgca tgaacccgtc      1560
     ggtcattatg ggctgaacat tatgcgcgag cgcgcggagc ggctcggcgg cacgctgaat      1620
     ttttcgcaac cttccggcgg cggcacgctg gtcagtatca gttttcgctc ctccagcggg      1680
     gaagatatag ccagttaa                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page