(data stored in SCRATCH zone)

EMBL: CP000880.PE386

CP000880.PE386       Location/Qualifiers
FT   CDS_pept        complement(408574..408822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20340"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR2"
FT                   /protein_id="ABX20340.1"
FT                   /translation="MSDRAVRTATGAGRILAMMTCYRAALMLMFDDSNSGLIALWRQYM
FT                   SLIIVSHYTGDLAGMAPQALLAIGHNKTIHGVLLFWL"
     atgagcgatc gcgccgttcg gacagctacg ggcgcagggc gcatcctcgc aatgatgaca        60
     tgttaccgcg ctgcgctgat gttgatgttt gatgacagta attcggggct gatagcgctg       120
     tggcgtcagt acatgtcgct catcattgtg agccattaca caggcgacct cgcaggcatg       180
     gcaccccagg cactgctggc tattggccat aataaaacga ttcatggcgt ccttctgttt       240
     tggttgtaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page