(data stored in SCRATCH zone)

EMBL: CP000880.PE388

CP000880.PE388       Location/Qualifiers
FT   CDS_pept        411411..412013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2793 7.2e-90 yffH; hypothetical
FT                   protein YffH K01515; COG: COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20342"
FT                   /db_xref="GOA:A9MHR4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHR4"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:HMMTigr:IPR004385"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457011.1"
FT                   /func_characterised="similar sequence"
FT                   /protein_id="ABX20342.1"
FT                   /translation="MFLLHPGASMSQNITLIKDKILSDNYFTLRNITYDLTRRNGKVIR
FT                   HKREVYDRGNGATILLYNSTKKTVVLVRQFRVATWVNGNEDGMLIETCAGLLDNDEPEV
FT                   CIRKEAIEETGYDVGEVRKIFELYMSPGGVTELIHFFIAEYRDSERASTGGGVEDEDIE
FT                   VLELPFSRALEMARSGEIRDGKTVLLLNYLHMSHLMG"
     atgttccttt tacaccctgg agccagtatg tcgcaaaaca ttacgcttat taaggataaa        60
     attctttctg ataattattt cacgctgcgc aacattacct atgacctgac ccgtcgcaat       120
     ggcaaggtca tccgccacaa gcgtgaggtt tacgatcgcg ggaatggcgc gaccattctg       180
     ctttacaact caaccaaaaa aaccgtggtt ctggttcgcc agtttcgcgt ggcgacatgg       240
     gtaaatggta atgaagacgg catgttaatt gaaacctgcg ctggcttgct cgataacgac       300
     gagccggagg tctgtatccg taaagaggcc attgaagaga cagggtatga tgtcggtgag       360
     gtacgcaaga tatttgagct ttatatgtcg ccaggcggcg tcacagagtt gattcatttc       420
     tttattgccg aatatcgcga tagcgagcgc gccagcacgg ggggcggtgt ggaggacgaa       480
     gatatcgagg tgcttgaact gccgttttcc cgggcgctgg aaatggcgcg ctcgggagag       540
     attcgggacg gtaagacggt gttattgctt aactatttac atatgtctca tctaatgggt       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page