(data stored in SCRATCH zone)

EMBL: CP000880.PE390

CP000880.PE390       Location/Qualifiers
FT   CDS_pept        413310..413540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00408"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31287 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20344"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR6"
FT                   /inference="similar to AA sequence:INSD:AAL21369.1"
FT                   /protein_id="ABX20344.1"
FT                   /translation="MKINNGPVLCPHCGCLSAYYEIDRLAAIREKVNKEGGSKAWDSTL
FT                   QAHKKKAFCLMCHKSIDEAVIGQSDAPESAR"
     atgaaaataa ataatggccc cgtattatgc ccccattgtg gctgcctgag cgcttattat        60
     gaaatagatc ggctggcggc gataagagaa aaagttaata aagaaggggg ctcaaaggcg       120
     tgggattcca ctttgcaggc gcataaaaaa aaggcctttt gcctgatgtg ccataaatct       180
     attgacgagg ccgtcatcgg gcaatctgat gcgcctgagt ctgcgaggta a                231
//

If you have problems or comments...

PBIL Back to PBIL home page