(data stored in SCRATCH zone)

EMBL: CP000880.PE409

CP000880.PE409       Location/Qualifiers
FT   CDS_pept        434378..435274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2457 1.2e-149 eutC; ethanolamine
FT                   ammonia-lyase, light chain K03736; COG: COG4302
FT                   Ethanolamine ammonia-lyase, small subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20363"
FT                   /db_xref="GOA:A9MIC6"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIC6"
FT                   /inference="protein motif:HMMPfam:IPR009246"
FT                   /inference="similar to AA sequence:INSD:AAC78124.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20363.1"
FT                   /translation="MDQKQIEEIVRSVMASMGQDVPQPVAPSTQEGAKPQRAAPTATES
FT                   CALDLGSAEAKAWIGVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSR
FT                   SKDTVLKEVPEEWVKAQGLLEVRSEISDKNRYLTRPDMGRRLSQEAIDALKSQCVMNPD
FT                   VQVVISDGLSTDAITANYEEILPPLLAGLKQAGLKVGTPFFVRYGRVKIEDQIGELLGA
FT                   KVVILLVGERPGLGQSESLSCYAVYSPRVTTTVEADRTCISNIHQGGTPPVEAAAVIVD
FT                   LAKRMLEQKASGINMTR"
     atggatcaaa aacagattga agaaattgta cgtagcgtga tggcgtcaat gggacaggac        60
     gtaccgcaac ccgtcgcgcc gtcaacgcag gaaggcgcaa agccgcagcg cgccgcgccg       120
     acggcgactg aaagctgcgc gctggatttg ggttccgcgg aggcaaaagc ctggattggc       180
     gtcgagaacc cgcatcgtgc ggatgtgctg accgaactgc gtcgcagtac tgcggcacgc       240
     gtctgtactg gtcgtgccgg gccgcgtcca cgtacccagg cgctgttacg cttcctggcg       300
     gatcactccc gttcgaaaga caccgtgctc aaagaggtgc cggaagaatg ggtgaaagcc       360
     caagggctgc tagaagtgcg ttcggaaatc agcgacaaaa accgctacct gacccgcccg       420
     gatatggggc gtcgcctgag ccaggaagcc attgacgcgc tgaaatcgca gtgtgtgatg       480
     aacccggatg tgcaggtggt gatctccgac ggcctctcta cggatgcgat caccgctaac       540
     tatgaagaga tcctgccacc gctgctggcg ggtctgaaac aggcagggct taaggttggc       600
     acgccgttct ttgtgcgcta tggccgcgtg aagattgaag atcaaattgg cgagcttctt       660
     ggcgcaaaag tagtgatttt gctggtgggc gaacgtccgg gcttaggcca gtcggaaagc       720
     ctttcctgct acgccgtgta ctcgccgcgc gtaacgacca ccgtcgaagc ggatcgtacc       780
     tgtatttcga atattcacca gggcggtacg ccgccggtag aagcggccgc cgtgattgtg       840
     gatttggcca aacggatgct ggagcagaaa gcgtccggta tcaatatgac ccgttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page