(data stored in SCRATCH zone)

EMBL: CP000880.PE413

CP000880.PE413       Location/Qualifiers
FT   CDS_pept        complement(437664..438563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0415 1.3e-161 hemF; coproporphyrinogen
FT                   III oxidase K00228; COG: COG0408 Coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20367"
FT                   /db_xref="GOA:A9MID0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MID0"
FT                   /inference="protein motif:HMMPanther:IPR001260"
FT                   /inference="protein motif:HMMPfam:IPR001260"
FT                   /inference="protein motif:HMMPIR:IPR001260"
FT                   /inference="protein motif:ScanRegExp:IPR001260"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456986.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20367.1"
FT                   /translation="MKPDAQHVKQFLLRLQDDICQTLSAVDGANFIEDSWRREAGGGGR
FT                   SRVLRNGGIFEQAGVNFSHVNGDAMPASATAHRPELVGRSFEAMGVSLVVHPRNPYIPT
FT                   SHANVRFFIAEKPGADPVWWFGGGFDLTPYYGFEEDAVHWHRTARDLCQPFGEDVYPRY
FT                   KKWCDDYFFIKHRNEQRGIGGLFFDDLNTPDFASCFAFMQAVGKGYTEAYLPIVERRKT
FT                   MAWGERERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEYDYQPK
FT                   EGSPEAALSEFIQVRDWV"
     atgaagcccg atgcacaaca cgtaaaacag tttctgctac gcctgcagga tgatatttgc        60
     caaacgttat ccgctgtgga tggcgcaaac tttatcgaag atagctggcg acgcgaagcg       120
     ggcggcggcg gacgtagtcg ggtattacgc aacggcggga ttttcgaaca ggcgggcgtt       180
     aatttctctc acgttaacgg cgatgcgatg cccgcgtccg ccaccgcgca tcgcccggaa       240
     cttgtcgggc ggagctttga agcgatgggc gtgtcgctgg tagtacatcc gcgcaatccg       300
     tatattccca ccagccacgc taacgtgcgc ttttttattg ccgaaaaacc gggcgccgat       360
     ccggtgtggt ggtttggcgg cgggttcgat ttaacgccct actacggttt tgaagaggat       420
     gccgttcact ggcaccgcac ggcgcgggat ctctgccagc cgttcggcga agacgtttat       480
     ccacgctata aaaagtggtg cgacgactac ttcttcatta agcaccgcaa cgagcagcgc       540
     ggcattggcg gattattctt tgacgacctg aatacgccgg atttcgccag ttgctttgcg       600
     tttatgcagg cggtaggtaa aggctatacc gaggcgtatc tgcccattgt cgagcggcgt       660
     aaaactatgg cttggggtga gcgcgagcgc agtttccagc tctatcgtcg cggtcgctat       720
     gtcgaattta atctggtatg ggatcgcggc acgctgtttg gcttacagac cgggggacgc       780
     accgaatcca tcctgatgtc gatgccgccg ttagtgcgct gggaatacga ttaccagccc       840
     aaggaaggca gcccggaggc agcattgagc gagtttattc aggtacgcga ctgggtgtaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page