(data stored in SCRATCH zone)

EMBL: CP000880.PE416

CP000880.PE416       Location/Qualifiers
FT   CDS_pept        440060..440509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00434"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08687 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20370"
FT                   /db_xref="GOA:A9MID3"
FT                   /db_xref="InterPro:IPR021318"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID3"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217434.1"
FT                   /protein_id="ABX20370.1"
FT                   /translation="MKSTEFHPADYDVHGRLRLPFLFWCVLLLQARAWILFVIAGSSRE
FT                   QGNTLLNFFYPDHDNFWLGLLPGVPAVVAFLLSGRREAFPGMWRMLRGWLILAQLVLLC
FT                   WQPALWLSGESVNGAGMALFVVDIVALIWLVTHRRCRACFVSGKE"
     atgaagagta ctgagtttca tccagccgat tatgacgtac acggacgttt acgtctgccg        60
     tttctcttct ggtgcgtgct gctacttcaa gcgcgcgcat ggatactctt tgtcattgcc       120
     ggttcatccc gtgaacaggg taatactttg ttaaactttt tttaccccga ccatgataat       180
     ttttggctgg gactgttgcc tggcgttccg gcggtagtgg cgtttttact cagcgggcgg       240
     cgtgaagcat ttcctgggat gtggcgtatg ctacgaggat ggctcattct ggcgcaactg       300
     gtattgcttt gctggcaacc tgcgttatgg ctgtctgggg aatcggttaa tggcgctggg       360
     atggcgcttt ttgtagtgga tatcgtcgcg cttatctggc tggtcactca ccgtcgttgc       420
     cgcgcctgtt ttgtctccgg aaaagaataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page