(data stored in SCRATCH zone)

EMBL: CP000880.PE418

CP000880.PE418       Location/Qualifiers
FT   CDS_pept        441240..442136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0946 1.3e-42 predicted iron-dependent
FT                   peroxidase K00430; COG: COG2837 Predicted iron-dependent
FT                   peroxidase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20372"
FT                   /db_xref="GOA:A9MID5"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID5"
FT                   /inference="protein motif:HMMPfam:IPR006314"
FT                   /inference="protein motif:HMMTigr:IPR006314"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804281.1"
FT                   /protein_id="ABX20372.1"
FT                   /translation="MSQVQSGILPEHCRAAIWIEANVKGDVDALRAASRTFADKLATFE
FT                   VKFPDANLGAVVAFGNNTWRALSGVGAEELKDFIPYGKGLAPATQYDVLIHILSLRHDV
FT                   NFSVAQAAMEAFGDCIDVKEEVHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGV
FT                   DAGGSYVFVQRWEHNLKQLNRMSIHDQEMMIGRTKEANEEIDGDSRPATSHLSRVDLKE
FT                   EGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTKP
FT                   VTGGYYFAPSLDRLLAL"
     atgtctcagg ttcaaagcgg cattttgccg gaacattgcc gtgcggcaat ttggattgaa        60
     gctaatgtga aaggcgacgt ggatgccctg cgcgcagcca gcagaacgtt tgccgataaa       120
     ctggcgacct tcgaagtgaa atttccggat gccaatctgg gcgctgttgt ggcgtttggc       180
     aacaatacct ggcgcgccct gagcggcgtc ggggcggaag aactgaaaga ctttatccct       240
     tatggtaaag ggctggcgcc agccacgcag tatgatgtgc tgatccacat tctttccctg       300
     cgccacgatg tgaatttttc tgttgcccag gcggcgatgg aagcctttgg cgactgcatc       360
     gatgtgaaag aagaagttca cggcttccgt tgggtggaag aacgcgacct gagcggcttt       420
     gtcgacggga cagagaatcc ggcgggcgaa gagacgcgcc gtgaagtggc ggtaatcaaa       480
     gatggtgtgg atgccggcgg cagttatgtg ttcgtgcagc gttgggaaca caatctcaag       540
     cagcttaacc ggatgagtat tcacgatcag gagatgatga tcggtcgtac caaagaggct       600
     aatgaagaaa tcgatggtga ttcgcgcccg gcaacgtccc acctgagccg cgtggatctg       660
     aaagaagagg gtaaagggct gaagattgtg cgccagagcc tgccatacgg cactgccagc       720
     ggtacgcacg gtctctattt ttgcgcttac tgcgcgcgcc tgcataatat cgaacagcag       780
     cttctgagta tgttcggcga taccgatggt aaacgcgacg cgatgctgcg cttcaccaaa       840
     ccggtgaccg gcggctacta ttttgcgccg tcgctggatc gtctgttggc gctgtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page