(data stored in SCRATCH zone)

EMBL: CP000880.PE424

CP000880.PE424       Location/Qualifiers
FT   CDS_pept        447746..448609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0825 3.2e-22 glucokinase K00845; COG:
FT                   COG1737 Transcriptional regulators; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20378"
FT                   /db_xref="GOA:A9MIE1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR022821"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIE1"
FT                   /inference="protein motif:HMMPfam:IPR000281"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737907.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20378.1"
FT                   /translation="MLYLAKMRNAEGEFTENEQKIATFLLAHVGELKTVSSRNMAKQLE
FT                   ISQSSIVKFAQKLGANGFTELRMALIEEHSVSREKKRDKAVHLHSSITSEDSLEMMARK
FT                   LNREKIVALEETYNLMDYERLEQVINLISKAPLIQITGVGGSALVGRDLSFKLMKIGFR
FT                   VACEVDTHVQATIAQALRQGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSP
FT                   LRRLADYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGMVQLNDVESLRMIERSSELI
FT                   TLLDRS"
     atgctatatc tggcgaaaat gcgtaatgca gagggcgagt ttacggaaaa cgagcagaaa        60
     attgccactt tcctgctggc gcatgttggt gaattgaaaa cggtttcctc ccgcaatatg       120
     gcgaagcagt tggagatcag ccagtcgagt attgtgaaat ttgcccaaaa attgggggcg       180
     aatgggttca ctgaacttcg aatggcgctc attgaagaac acagcgtcag tcgtgaaaag       240
     aagcgggata aggccgtgca tttgcacagc tccattacca gtgaagacag cctggagatg       300
     atggcccgta agctgaacag ggaaaaaatt gtcgctcttg aagagaccta taatctgatg       360
     gattacgagc gactggagca ggtgattaac cttatcagta aggctccgct cattcagatt       420
     accggagtcg gaggatcggc cctggtgggg cgcgatttat cctttaagct gatgaaaata       480
     ggttttcgcg ttgcctgcga ggtcgacacc catgtgcagg caacgattgc ccaagcgtta       540
     cggcaaggag atgtgcaaat cgccatttct tatagcggat caaaaaaaga gattgtgctt       600
     tgcgctgagg cggcccgtaa gcagggcgcg acggtgattg cgattacctc attggctgat       660
     tctccgctgc gacggctggc ggattacacg ctggataccg tttccggcga gacggaatgg       720
     cgcagctcgt ctatgtctac ccgaacggcg caaaactcgg tcaccgacct gcttttcgtc       780
     ggcatggtgc aattgaatga cgtagagtcg cttcgcatga tcgaacgcag cagcgaactg       840
     attacgcttt tggatcgaag ctag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page