(data stored in SCRATCH zone)

EMBL: CP000880.PE425

CP000880.PE425       Location/Qualifiers
FT   CDS_pept        448727..449518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2445 6.1e-132 ucpA; putative
FT                   oxidoreductase; COG: COG1028 Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20379"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE2"
FT                   /inference="protein motif:HMMPanther:IPR002347"
FT                   /inference="protein motif:HMMPfam:IPR002198"
FT                   /inference="similar to AA sequence:INSD:AAO68131.1"
FT                   /protein_id="ABX20379.1"
FT                   /translation="MGKLTGKTALVTGASQGIGEGIVRVFARHGANLILLDISDEIEKL
FT                   ADELGGRGHRCTAVKADVRDFASVQAAVARAKEIEGRIDILVNNAGVCRLGNFLDMSEE
FT                   DRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDIVADPGETAYALSKAAIV
FT                   GLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPLRRLA
FT                   DPLEVGELAAFLASDESSYLTGTQNVIDGGSTLPESVSVGV"
     atgggtaaac tcacgggcaa gacagcattg gttacgggcg catcacaggg catcggcgaa        60
     gggatcgtcc gcgtattcgc acgccacggc gcgaacttaa tcttgctgga tatctccgat       120
     gagattgaaa agctggcgga tgaactgggc gggcgcggac accgctgtac tgccgttaag       180
     gctgacgtca gggattttgc ttcggtgcag gcggcggttg cgcgcgctaa agagattgaa       240
     ggtagaattg atattttggt gaataacgct ggcgtatgcc gtctgggcaa cttccttgat       300
     atgagtgaag aagatcgcga ttttcacatt gatattaata ttaaaggcgt ctggaacgtg       360
     accaaagccg tcctgcctga gatgatcaaa cgtaaagatg gccgtattgt gatgatgtct       420
     tccgtcacgg gagatatagt ggcggaccct ggcgaaacgg cctatgcgtt gtcgaaagcc       480
     gccattgtcg gtttaaccaa atcgctggcg gtggagtatg cgcagtccgg tattcgcgtg       540
     aatgctatct gccccggtta tgtaagaacg ccgatggcgg aaagcattgc ccgtcagtct       600
     aaccctgaag atccggagtc ggtattaact gaaatggcaa aagccattcc gctacgccgt       660
     cttgccgatc cgctggaagt aggagagctg gcggcgttcc tggcttccga tgagtccagc       720
     tatcttaccg gaacgcaaaa cgtcattgat ggcggcagca ccctgcctga aagcgtgagc       780
     gtaggcgtct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page