(data stored in SCRATCH zone)

EMBL: CP000880.PE427

CP000880.PE427       Location/Qualifiers
FT   CDS_pept        450691..451524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll0739 1.3e-29 modBC; ABC-type molybdate
FT                   transport system permease/ATP-binding protein K02018; COG:
FT                   COG0555 ABC-type sulfate transport system, permease
FT                   component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20381"
FT                   /db_xref="GOA:A9MIE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE4"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011865"
FT                   /inference="similar to AA sequence:SwissProt:P41032"
FT                   /protein_id="ABX20381.1"
FT                   /translation="MLAMSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWA
FT                   QYWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPF
FT                   ALPTAVAGLTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVL
FT                   EELGPEYEEAAQTLGATRLQSFRKVVLPELSPALVAGIALSFTRSLGEFGAVIFIAGNI
FT                   AWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH"
     atgcttgcca tgtcttcccg acgcgtgctg cccggcttta cgttaagcct gggcaccagt        60
     ttgctgtttg tttgcctgat tctgctgttg ccgctgagcg cgctggtgat gcagctttca       120
     caaatgagct gggcgcaata ctgggatgtc gtgaccaacc cgcaggtggt ggccgcctat       180
     aaagtgacgc tgctggcggc atttgtggcg tcgattttta acggcgtgtt tggtctgctg       240
     atggcgtgga ttttaactcg ttatcgtttt cctgggcgca cgttgttgga tgcgctgatg       300
     gatctgccgt ttgccctgcc gacggcagta gcggggttaa cgctggcctc gctattctcg       360
     gtgaacggtt tttacgggca gtttctcgcg cagtttgata tcaaagtcac ctatacctgg       420
     ctcggtattg cggtggcgat ggcctttacc agcattccat ttgtggtgcg taccgtccag       480
     ccggtactgg aagaactggg gccggaatat gaagaagcgg cacaaacgct gggggccacc       540
     cgcctgcaaa gttttcgcaa agtggtgctg cctgagctgt cgcctgcgtt ggtggcgggg       600
     atcgccctgt cgtttacccg cagccttggc gagtttggcg cggtgatttt tatcgccggg       660
     aatatcgcgt ggaaaacaga agtgacctcg ctgatgattt ttgtacgttt gcaggagttt       720
     gactatcccg ccgccagcgc cattgcctcg gtgatccttg cggcatcctt gttgctactg       780
     ttttcgatta acacgttaca aagtcgcttt ggccgacgcg tggtaggtca ctaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page